Property Summary

NCBI Gene PubMed Count 39
PubMed Score 38.79
PubTator Score 28.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Warburg Sjo Fledelius syndrome 4
Disease Target Count P-value
osteosarcoma 7933 8.37236136723567E-11
ependymoma 2514 1.7478549721796E-10
glioblastoma 5572 6.0143039535317E-8
pediatric high grade glioma 2712 8.16706063949097E-8
psoriasis 6685 8.60377095230772E-8
pilocytic astrocytoma 3086 1.9539660869107E-7
atypical teratoid / rhabdoid tumor 4369 6.72315429632558E-7
medulloblastoma, large-cell 6234 2.71550016015283E-6
medulloblastoma 1524 8.7557047086046E-6
Pick disease 1893 9.31178804658448E-6
ovarian cancer 8492 2.52277417098815E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.47166862706843E-4
acute quadriplegic myopathy 1157 0.00100559252912663
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00158977518629804
lung adenocarcinoma 2714 0.00173883495628464
pituitary cancer 1972 0.00352825364446467
hereditary spastic paraplegia 313 0.00508918026835871
primitive neuroectodermal tumor 3031 0.0062132422041653
Rheumatoid Arthritis 1171 0.0444053095991748
Disease Target Count Z-score Confidence
Large cell medulloblastoma 1 3.765 1.9

Expression

  Differential Expression (19)

Synonym

Accession Q9NP72 B3KMC7 B7Z333 D3DRW1 Q53FX8 Q56UN9 Q6FIH1
Symbols WARBM3
RAB18LI1

Gene

PDB

1X3S  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (17)

PMID Text
26063829 Warburg Micro syndrome is caused by RAB18 deficiency.
24997429 These results suggest that Rab18 has an important role in viral assembly through the trafficking of the hepatitis C virus core protein to lipid droplets.
24996981 findings suggest that RAB18 rs3765133 polymorphism affects the development of specific brain regions, particularly the cerebellum, in healthy people
24891604 Rab18 and a Rab18 GEF complex of Rab3GAP1 and Rab3GAP2 have roles in the endoplasmic reticulum structure
24696471 Rab18-mediated membrane trafficking of FASN and NS3 facilitates dengue virus replication.
24477653 High RAB18 expression is associated with glioma.
23935497 Rab18 interacts with the HCV nonstructural protein NS5A.
23471881 Hepatitis B virus X protein enhances proliferation of hepatoma cells through Rab18.
23420520 One-hundred and forty-four Micro and nine Martsolf families were investigated, identifying mutations in RAB3GAP1 in 41% of cases, mutations in RAB3GAP2 in 7% of cases, and mutations in RAB18 in 5% of cases
23176487 Micro syndrome has been associated with causative mutations in three disease genes: RAB3GAP1, RAB3GAP2 and RAB18. Martsolf syndrome has been associated with a mutation in RAB3GAP2. [Review]
More...

AA Sequence

MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERF      1 - 70
RTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFA     71 - 140
RKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL        141 - 206
//

Text Mined References (42)

PMID Year Title
26063829 2015 Warburg Micro syndrome is caused by RAB18 deficiency or dysregulation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24997429 2014 Rab18 is required for viral assembly of hepatitis C virus through trafficking of the core protein to lipid droplets.
24996981 2014 The association of RAB18 gene polymorphism (rs3765133) with cerebellar volume in healthy adults.
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24696471 2014 Rab18 facilitates dengue virus infection by targeting fatty acid synthase to sites of viral replication.
24477653 2014 miR-200b as a prognostic factor targets multiple members of RAB family in glioma.
24239381 2013 Loss-of-function mutations in TBC1D20 cause cataracts and male infertility in blind sterile mice and Warburg micro syndrome in humans.
23935497 2013 Rab18 binds to hepatitis C virus NS5A and promotes interaction between sites of viral replication and lipid droplets.
More...