Property Summary

NCBI Gene PubMed Count 84
Grant Count 92
R01 Count 73
Funding $5,792,809.75
PubMed Score 183.57
PubTator Score 107.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma -1.100 0.000
primitive neuroectodermal tumor -1.200 0.000
breast carcinoma -2.200 0.001
fibroadenoma -3.200 0.009
ductal carcinoma in situ -1.600 0.001
invasive ductal carcinoma -1.500 0.012

Synonym

Accession Q9NP71 C5HU02 C5HU03 C5HU04 Q96E48 Q9BY03 Q9BY04 Q9BY05 Q9BY06 Q9Y2P3 ChREBP
Symbols MIO
MLX
CHREBP
MONDOB
WBSCR14
WS-bHLH
bHLHd14

Gene

Gene RIF (62)

PMID Text
27033449 High glucose-mediated induction of PDGF-C via ChREBP in mesangial cells contributes to the development of glomerular mesangial expansion in diabetes.
26910886 Evaluation of the conservation of ChREBP and MondoA sequences demonstrate that MondoA is better conserved and potentially mediates more ancient function in glucose metabolism.
26526060 Diet-induced obesity increases basal expression of ChREBPbeta, which may increase the risk of developing hepatic steatosis, and fructose-induced activation is independent of gluconeogenesis.
26384380 Data suggest that expression of ChREBPbeta isoform is up-regulated in pancreatic beta-cells in response to elevated levels of glucose (i.e., hyperglycemic conditions).
26177557 the single nucleotide polymorphism of MLXIPL is significantly associated with Non-alcoholic Fatty Liver Disease.
26147751 Metformin down-regulates high-glucose-induced TXNIP transcription by inactivating ChREBP and FOXO1 in endothelial cells, partially through AMP-activated protein kinase activation
26124292 A major function of Mio in mitosis is to regulate the activation/deactivation of Plk1 and Aurora A.
25573592 Polymorphisms in lipid level modifier MLXIPL, GCKR, GALNT2, CILP2, ANGPTL3 and TRIB1 genes are highly associated with plasma lipid level changes.
25288136 Single-nucleotide polymorphisms alleles near MLXIPL that were associated with higher coffee consumption.
25111846 results demonstrate that AGEs-RAGE signaling enhances cancer cell proliferation in which AGEs-mediated ChREBP induction plays an important role.
More...

AA Sequence

MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEG      1 - 70
SVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKS     71 - 140
PVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIEVVMREYHKWRIYYKKRLRKPSREDDLLAPKQAEGR    141 - 210
WPPPEQWCKQLFSSVVPVLLGDPEEEPGGRQLLDLNCFLSDISDTLFTMTQSGPSPLQLPPEDAYVGNAD    211 - 280
MIQPDLTPLQPSLDDFMDISDFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHL    281 - 350
SGHSRLQARNSCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAP    351 - 420
PTALLQEEPLFSPRFPFPTVPPAPGVSPLPAPAAFPPTPQSVPSPAPTPFPIELLPLGYSEPAFGPCFSM    421 - 490
PRGKPPAPSPRGQKASPPTLAPATASPPTTAGSNNPCLTQLLTAAKPEQALEPPLVSSTLLRSPGSPQET    491 - 560
VPEFPCTFLPPTPAPTPPRPPPGPATLAPSRPLLVPKAERLSPPAPSGSERRLSGDLSSMPGPGTLSVRV    561 - 630
SPPQPILSRGRPDSNKTENRRITHISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYI    631 - 700
LMLQQERAGLQEEAQQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWV    701 - 770
FSILIRPLFESFNGMVSTASVHTLRQTSLAWLDQYCSLPALRPTVLNSLRQLGTSTSILTDPGRIPEQAT    771 - 840
RAVTEGTLGKPL                                                              841 - 852
//

Text Mined References (86)

PMID Year Title
27033449 2016 High glucose induces platelet-derived growth factor-C via carbohydrate response element-binding protein in glomerular mesangial cells.
26910886 2016 Contrasting Patterns in the Evolution of Vertebrate MLX Interacting Protein (MLXIP) and MLX Interacting Protein-Like (MLXIPL) Genes.
26526060 2016 Tissue Specific Effects of Dietary Carbohydrates and Obesity on ChREBP? and ChREBP? Expression.
26384380 2015 Induction of the ChREBP? Isoform Is Essential for Glucose-Stimulated ?-Cell Proliferation.
26177557 2014 Is C771G polymorphism of MLX interacting protein-like (MLXIPL) gene a novel genetic risk factor for non-alcoholic fatty liver disease?
26147751 2015 New Insight Into Metformin Action: Regulation of ChREBP and FOXO1 Activities in Endothelial Cells.
26124292 2015 Mio depletion links mTOR regulation to Aurora A and Plk1 activation at mitotic centrosomes.
25573592 2015 Functional variants of lipid level modifier MLXIPL, GCKR, GALNT2, CILP2, ANGPTL3 and TRIB1 genes in healthy Roma and Hungarian populations.
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
25111846 2014 Advanced glycation end products increase carbohydrate responsive element binding protein expression and promote cancer cell proliferation.
More...