Property Summary

NCBI Gene PubMed Count 25
Grant Count 94
R01 Count 59
Funding $10,250,287.46
PubMed Score 99.00
PubTator Score 100.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
lung cancer 5.700 0.000
ovarian cancer 1.300 0.000
psoriasis -1.300 0.000

Synonym

Accession Q9NP70 Q3B862 Q9H2X1 Q9H4L1
Symbols AI1F

Gene

PANTHER Protein Class (1)

Gene RIF (16)

PMID Text
26223266 Authors perform an evolutionary analysis of mammalian AMBN sequences in order to predict functionally important sites of the protein and to identify candidate disease-associated mutations responsible for the protein function and identify AMBN as a candidate for amelogenesis imperfect in humans.
26070558 Protein interaction between Ambn and Psma3 can facilitate redistribution of ameloblastin domains within forming enamel.
25373699 two genetic variants (rs2337359 upstream of TUFT1 and missense rs7439186 in AMBN) involved in gene-by-fluoride interactions.
24858907 Report shows for the first time that AMBN mutations cause non-syndromic human amelogenesis imperfecta and confirms that mouse models with disrupted Ambn function are valid.
24203249 Association between caries experience (caries-free versus caries affected) depending on asthma status and SNPs was tested. Logistic regression showed an association between AMBN rs4694075 and caries experience. Ameloblastin is associated w/caries in asthmatic children.
23790503 We found a trend for association between variation in AMBN and MIH in both cohorts, which may suggest that variation in the regulation of AMBN is a mechanism that leads to MIH.
23782691 AMBN ribbons exhibited lengths ranging from tens to hundreds of nm. Deletion analysis and NMR spectroscopy revealed that N-terminal segment encoded by exon 5 comprises two short independently structured regions and plays a role in self-assembly of AMBN
21761392 AMBN does not influence osteogenic activity in vitro under the conditions used
21149578 ameloblastin is expressed in osteoblasts and functions as a promoting factor for osteogenic differentiation via a novel pathway through the interaction between CD63 and integrin beta1
20854943 Findings suggest a role for this protein in early bone formation and repair.
More...

AA Sequence

MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMASLSLETMRQLGSLQRLNTLSQYSRYGFGKS      1 - 70
FNSLWMHGLLPPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATAL     71 - 140
KEALQPPIHLGHLPLQEGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQGPSLPGLDFA    141 - 210
DPQGSTIFQIARLISHGPMPQNKQSPLYPGMLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFP    211 - 280
GFGGMRPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDNLENPAFLTELEPAPH    281 - 350
AGLLALPKDDIPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDADMTTSVDFQEEATMDTTMAP    351 - 420
NSLQTSMPGNKAQEPEMMHDAWHFQEP                                               421 - 447
//

Text Mined References (26)

PMID Year Title
26223266 2015 Evolutionary analysis of selective constraints identifies ameloblastin (AMBN) as a potential candidate for amelogenesis imperfecta.
26070558 2015 Protein Interaction between Ameloblastin and Proteasome Subunit ? Type 3 Can Facilitate Redistribution of Ameloblastin Domains within Forming Enamel.
25789606 2015 A secretory kinase complex regulates extracellular protein phosphorylation.
25373699 2015 Effects of enamel matrix genes on dental caries are moderated by fluoride exposures.
24858907 2014 Deletion of ameloblastin exon 6 is associated with amelogenesis imperfecta.
24203249 2014 Genetic variation in Ameloblastin is associated with caries in asthmatic children.
23790503 2013 Genes expressed in dental enamel development are associated with molar-incisor hypomineralization.
23782691 2013 Intrinsically disordered enamel matrix protein ameloblastin forms ribbon-like supramolecular structures via an N-terminal segment encoded by exon 5.
21761392 2011 Ameloblastin is not implicated in bone remodelling and repair.
21149578 2011 Ameloblastin regulates osteogenic differentiation by inhibiting Src kinase via cross talk between integrin beta1 and CD63.
More...