Property Summary

NCBI Gene PubMed Count 26
PubMed Score 103.93
PubTator Score 100.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 3.900 1.0e-05
medulloblastoma, large-cell 1.100 2.0e-04
ovarian cancer 1.300 3.1e-11
psoriasis -1.300 7.4e-05

Gene RIF (17)

AA Sequence

MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMASLSLETMRQLGSLQRLNTLSQYSRYGFGKS      1 - 70
FNSLWMHGLLPPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATAL     71 - 140
KEALQPPIHLGHLPLQEGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQGPSLPGLDFA    141 - 210
DPQGSTIFQIARLISHGPMPQNKQSPLYPGMLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFP    211 - 280
GFGGMRPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDNLENPAFLTELEPAPH    281 - 350
AGLLALPKDDIPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDADMTTSVDFQEEATMDTTMAP    351 - 420
NSLQTSMPGNKAQEPEMMHDAWHFQEP                                               421 - 447
//

Text Mined References (27)

PMID Year Title