Property Summary

NCBI Gene PubMed Count 23
PubMed Score 4.28
PubTator Score 5.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Type 2 142 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.0
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count Z-score Confidence
Cowpox 16 3.525 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 2.0e-05

Gene RIF (5)

AA Sequence

MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEFVEDLSQGQLLQSESSNAAE      1 - 70
GNEQRHEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFPEITRMLGNE     71 - 140
WSKLPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFSRKTQDRQKGKSHRQDAARQATHDHEKETEV    141 - 210
KERSVFDIPIFTEEFLNHSKAREAELRQLRKSNMEFEERNAALQKHVESMRTAVEKLEVDVIQERSRNTV    211 - 280
LQQHLETLRQVLTSSFASMPLPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR       281 - 347
//

Text Mined References (31)

PMID Year Title