Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.34
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.100 4.5e-02
atypical teratoid / rhabdoid tumor -1.300 3.7e-07
ependymoma -1.100 2.6e-02
medulloblastoma, large-cell -1.500 4.4e-05
oligodendroglioma -1.100 1.1e-02
osteosarcoma 1.564 6.0e-05

Gene RIF (2)

AA Sequence

MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVK      1 - 70
LIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKG     71 - 140
HFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSES    141 - 210
DTGKRARHTSKDSKAAKKKKKKKKHKKKHKE                                           211 - 241
//

Text Mined References (20)

PMID Year Title