Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.84
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.70290802811118E-7
medulloblastoma, large-cell 6234 4.42055171266148E-5
osteosarcoma 7933 5.95274340089527E-5
oligodendroglioma 2849 0.0113702387917732
ependymoma 2514 0.0259647006938061
acute myeloid leukemia 785 0.0450056702300711

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.100 0.026
oligodendroglioma -1.100 0.011
osteosarcoma 1.564 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.500 0.000
acute myeloid leukemia -1.100 0.045

Synonym

Accession Q9NP64 B4DY38 D3DPN4 Q6PKH4 Q9NYG4 Q9P0M8 pNO40
Symbols PS1D
pNO40
HSPC251

Gene

PDB

2CQO  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (2)

PMID Text
18854154 Knockdown of zinc finger, CCHC domain containing 17 (ZCCHC17) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12893261 molecular cloning and characterization; it is localized to nucleoli of diverse cultured cells, with some concentration in the granular component of nucleoli

AA Sequence

MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVK      1 - 70
LIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKG     71 - 140
HFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSES    141 - 210
DTGKRARHTSKDSKAAKKKKKKKKHKKKHKE                                           211 - 241
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23455491 2013 NKAIN1-SERINC2 is a functional, replicable and genome-wide significant risk gene region specific for alcohol dependence in subjects of European descent.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...