Property Summary

NCBI Gene PubMed Count 44
PubMed Score 65.28
PubTator Score 50.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (36)

AA Sequence

MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSR      1 - 70
ILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHD     71 - 140
GRFIFFQSKGEHDHPKPETKLEAEARRAMKKVNTAPSSVSLSLKGSTETRSLPGETQSQGSLPLTWSFQE    141 - 210
GVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDLTDQTSTVDPMKLYEKRKLSSSRTYSSGDLL    211 - 280
PPSASGVYSDHGDLQAWSKNAALGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKT    281 - 350
GCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG    351 - 420
LDHCNNDMLLNLCPLR                                                          421 - 436
//

Text Mined References (45)

PMID Year Title