Property Summary

NCBI Gene PubMed Count 40
Grant Count 16
R01 Count 12
Funding $1,695,226.86
PubMed Score 63.58
PubTator Score 50.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (32)

PMID Text
26769961 GLI2 stabilized glial cell missing-a, a pivotal transcriptional factor for trophoblastic syncytialization.
26503785 reveals a positive feedback loop between glial cells missing 1 and Human chorionic gonadotropin regulating placental hCGbeta expression and cell differentiation
23651062 study reveals a novel function for RACK1 to regulate GCM1 activity and placental cell migration and invasion
23610556 Gcm1 and Fzd5 function in an evolutionary conserved positive feedback loop that regulates trophoblast differentiation and sites of chorionic branching morphogenesis.
23580611 Results suggest that caspase-14 may interact with GCM1 to participate in syncytiotrophoblast differentiation during placental development.
23438603 c-Myc-regulated members of the miR-17~92 and miR-106a~363 clusters inhibit trophoblast differentiation by repressing GCM1 and CYP19A1.
23300953 GCM1-directed villous trophoblast differentiation is repressed by DREAM
22975632 Phorbol 12-myristate 13-acetate-induced protein kinase C and mitogen-activated protein kinase kinase/extracellular signal regulated kinase dependent pathway enhances the degradation as well as the transcriptional activity of GCMa.
22778138 study reveals a novel function of GCM1 and HtrA4 in regulation of trophoblast invasion and that abnormal HrtA4 expression may contribute to shallow trophoblast invasion in preeclampsia
22275534 results support a role for reduced placental Gcm1 expression as a causative factor in defective syncytiotrophoblast differentiation and maternal and placental phenotypes in preeclampsia in humans.
More...

AA Sequence

MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSR      1 - 70
ILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHD     71 - 140
GRFIFFQSKGEHDHPKPETKLEAEARRAMKKVNTAPSSVSLSLKGSTETRSLPGETQSQGSLPLTWSFQE    141 - 210
GVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDLTDQTSTVDPMKLYEKRKLSSSRTYSSGDLL    211 - 280
PPSASGVYSDHGDLQAWSKNAALGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKT    281 - 350
GCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG    351 - 420
LDHCNNDMLLNLCPLR                                                          421 - 436
//

Text Mined References (40)

PMID Year Title
26769961 2016 Glioma-associated Oncogene 2 Is Essential for Trophoblastic Fusion by Forming a Transcriptional Complex with Glial Cell Missing-a.
26503785 2016 A Positive Feedback Loop between Glial Cells Missing 1 and Human Chorionic Gonadotropin (hCG) Regulates Placental hCG? Expression and Cell Differentiation.
23867755 2013 Involvement of Epac1/Rap1/CaMKI/HDAC5 signaling cascade in the regulation of placental cell fusion.
23651062 2013 RACK1 (receptor for activated C-kinase 1) interacts with FBW2 (F-box and WD-repeat domain-containing 2) to up-regulate GCM1 (glial cell missing 1) stability and placental cell migration and invasion.
23610556 2013 A positive feedback loop involving Gcm1 and Fzd5 directs chorionic branching morphogenesis in the placenta.
23580611 2013 Caspase-14 suppresses GCM1 acetylation and inhibits placental cell differentiation.
23438603 2013 The c-Myc-regulated microRNA-17~92 (miR-17~92) and miR-106a~363 clusters target hCYP19A1 and hGCM1 to inhibit human trophoblast differentiation.
23300953 2013 DREAM mediated regulation of GCM1 in the human placental trophoblast.
22975632 2012 PMA-induced GCMa phosphorylation stimulates its transcriptional activity and degradation.
22778138 2012 High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion.
More...