Property Summary

NCBI Gene PubMed Count 20
PubMed Score 22.83
PubTator Score 6.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
posterior fossa group B ependymoma 1.500 0.000
glioblastoma 1.100 0.014
adrenocortical carcinoma -1.227 0.000
tuberculosis -1.200 0.000
primary pancreatic ductal adenocarcinoma -1.014 0.006
active Crohn's disease 2.317 0.001
active ulcerative colitis 2.101 0.007
diabetes mellitus -1.300 0.005
Breast cancer 2.300 0.042
sonic hedgehog group medulloblastoma 1.100 0.003
ovarian cancer 2.300 0.000
dermatomyositis 1.100 0.002

Synonym

Gene

PDB

2CRW  

Gene RIF (6)

PMID Text
24076238 We suggest a model in which ArfGAP3 regulates Golgi association of GGA clathrin adaptors.
21647875 our results suggest that ARFGAP3 is a novel androgen-regulated gene that can promote prostate cancer cell proliferation and migration in collaboration with paxillin.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19299515 ArfGAP1, ArfGAP2, and ArfGAP3 have overlapping roles in regulating COPI function in Golgi-to-ER retrograde transport.
19015319 Differential roles of ArfGAP1, ArfGAP2, and ArfGAP3 in COPI trafficking
17760859 human ARFGAP2 and ARFGAP3 are associated with COP-I-coated vesicles and function in COP I traffic

AA Sequence

MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSN      1 - 70
WSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVP     71 - 140
PLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEV    141 - 210
SSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYK    211 - 280
DLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYF    281 - 350
TSSSSYFDEPVELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK    351 - 420
FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLPNAPDMAQFKQ    421 - 490
GVRSVAGKLSVFANGVVTSIQDRYGS                                                491 - 516
//

Text Mined References (29)

PMID Year Title
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24076238 2013 ArfGAP3 regulates the transport of cation-independent mannose 6-phosphate receptor in the post-Golgi compartment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21647875 2012 ARFGAP3, an androgen target gene, promotes prostate cancer cell proliferation and migration.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...