Property Summary

NCBI Gene PubMed Count 20
PubMed Score 23.83
PubTator Score 6.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 2.317 9.4e-04
active ulcerative colitis 2.101 6.9e-03
adrenocortical carcinoma -1.227 4.1e-04
Breast cancer 2.300 4.2e-02
dermatomyositis 1.100 1.6e-03
diabetes mellitus -1.300 5.2e-03
ependymoma 1.200 3.0e-09
glioblastoma 1.100 1.4e-02
malignant mesothelioma -1.200 7.8e-06
ovarian cancer 2.300 1.5e-04
primary pancreatic ductal adenocarcinoma -1.014 5.6e-03
sonic hedgehog group medulloblastoma 1.100 3.1e-03
tuberculosis -1.200 1.9e-06

Gene RIF (6)

AA Sequence

MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSN      1 - 70
WSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVP     71 - 140
PLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEV    141 - 210
SSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYK    211 - 280
DLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYF    281 - 350
TSSSSYFDEPVELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK    351 - 420
FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLPNAPDMAQFKQ    421 - 490
GVRSVAGKLSVFANGVVTSIQDRYGS                                                491 - 516
//

Text Mined References (29)

PMID Year Title