Property Summary

NCBI Gene PubMed Count 20
PubMed Score 22.83
PubTator Score 6.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.06145886317142E-7
tuberculosis 1563 1.89775718096668E-6
malignant mesothelioma 3163 7.75209397367599E-6
ovarian cancer 8492 1.52686587056659E-4
adrenocortical carcinoma 1427 4.13333113015768E-4
active Crohn's disease 918 9.37168626143271E-4
dermatomyositis 967 0.00155809609589407
sonic hedgehog group medulloblastoma 1482 0.00308052517007248
diabetes mellitus 1663 0.00524742346062439
primary pancreatic ductal adenocarcinoma 1271 0.00564149978537627
active ulcerative colitis 477 0.00687190754797945
glioblastoma 5572 0.0141608821064101
Breast cancer 3099 0.0422120126946889
Disease Target Count Z-score Confidence
Premature menopause 7 3.693 1.8

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
posterior fossa group B ependymoma 1.500 0.000
glioblastoma 1.100 0.014
adrenocortical carcinoma -1.227 0.000
tuberculosis -1.200 0.000
primary pancreatic ductal adenocarcinoma -1.014 0.006
active Crohn's disease 2.317 0.001
active ulcerative colitis 2.101 0.007
diabetes mellitus -1.300 0.005
Breast cancer 2.300 0.042
sonic hedgehog group medulloblastoma 1.100 0.003
ovarian cancer 2.300 0.000
dermatomyositis 1.100 0.002

Synonym

Gene

PDB

2CRW  

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (6)

PMID Text
24076238 We suggest a model in which ArfGAP3 regulates Golgi association of GGA clathrin adaptors.
21647875 our results suggest that ARFGAP3 is a novel androgen-regulated gene that can promote prostate cancer cell proliferation and migration in collaboration with paxillin.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19299515 ArfGAP1, ArfGAP2, and ArfGAP3 have overlapping roles in regulating COPI function in Golgi-to-ER retrograde transport.
19015319 Differential roles of ArfGAP1, ArfGAP2, and ArfGAP3 in COPI trafficking
17760859 human ARFGAP2 and ARFGAP3 are associated with COP-I-coated vesicles and function in COP I traffic

AA Sequence

MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSN      1 - 70
WSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVP     71 - 140
PLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEV    141 - 210
SSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYK    211 - 280
DLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYF    281 - 350
TSSSSYFDEPVELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK    351 - 420
FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLPNAPDMAQFKQ    421 - 490
GVRSVAGKLSVFANGVVTSIQDRYGS                                                491 - 516
//

Text Mined References (29)

PMID Year Title
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24076238 2013 ArfGAP3 regulates the transport of cation-independent mannose 6-phosphate receptor in the post-Golgi compartment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21647875 2012 ARFGAP3, an androgen target gene, promotes prostate cancer cell proliferation and migration.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...