Property Summary

Ligand Count 28
NCBI Gene PubMed Count 145
PubMed Score 289.77
PubTator Score 234.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Atransferrinemia 8 3.404 1.7
Liver disease 237 3.185 1.6
Siderosis 9 3.163 1.6
Disease Target Count
Aceruloplasminemia 16

Expression

Protein-protein Interaction (1)

Gene RIF (119)

AA Sequence

MTRAGDHNRQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAG      1 - 70
SVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKHELLTMYHGWVLTSCYILIITIA     71 - 140
NIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISG    141 - 210
WNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQ    211 - 280
EPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASA    281 - 350
ITGIMGTVAFTWLRRKCGLVRTGLISGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFIQGESITP    351 - 420
TKIPEITTEIYMSNGSNSANIVPETSPESVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERG    421 - 490
IINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHIMYFRFAQNTLGNKLFACGPDAKEV    491 - 560
RKENQANTSVV                                                               561 - 571
//

Text Mined References (147)

PMID Year Title