Property Summary

NCBI Gene PubMed Count 137
Grant Count 87
R01 Count 51
Funding $8,372,121.33
PubMed Score 262.28
PubTator Score 234.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NP59 Q6FI62 Q7Z4F8 Q8IVB2 Q9NRL0
Symbols FPN1
HFE4
MTP1
IREG1
MST079
MSTP079
SLC11A3

Gene

Gene RIF (110)

PMID Text
26666535 Erythroblasts from Beta-thalassemia patients showed a significantly reduced expression of total MTP1 protein.
26437604 The concentration of functional membrane-associated ferroportin is controlled by its ligand, the iron-regulatory hormone hepcidin, and fine-tuned by regulatory mechanisms serving iron homeostasis, oxygen utilization, host defense, and erythropoiesis.
26125411 TLR4 dependent macrophage signaling is controlled via hepcidin-ferroportin1 axis by influencing TLR4-lipid raft interactions
25976471 Single nucleotide polymorphisms in HAMP, BMP2, FTL and SLC40A1 genes have phenotype-modifying roles in hereditary hemochromatosis type 1.
25855377 we demonstrated that downregulation of FPN1 plays critical roles in promoting myeloma cell growth and bone resorption in multiple myeloma.
25805936 Decreased expression of hepcidin and ferroportin in hepatitis C patients indicates the importance of hepatocytic iron retention for viral response during pegylated-interferon plus ribavirin treatment.
25745821 Low hepcidin and high ferroportin expression by erythroblasts and macrophages were seen in iron deficiency anemia, while the opposite was true in anemia of chronic disorders.
25744489 study of healthy adults provides further evidence that ferroportin Q248H mutation affects serum ferritin concentration in Africans
25451081 The effects of abnormal FPN on tumor growth and the molecular mechanisms of diminished tumor FPN, were examined.
25441019 Several family members had hemochromatosis and hyperferritinemia associated with a SLC40A1 deletion in exon 5(485_487delTTG) resulting in the deletion of a valine residue (p.V162del). This is the 1st Spanish family reported with this European mutation.
More...

AA Sequence

MTRAGDHNRQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAG      1 - 70
SVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKHELLTMYHGWVLTSCYILIITIA     71 - 140
NIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISG    141 - 210
WNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQ    211 - 280
EPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASA    281 - 350
ITGIMGTVAFTWLRRKCGLVRTGLISGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFIQGESITP    351 - 420
TKIPEITTEIYMSNGSNSANIVPETSPESVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERG    421 - 490
IINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHIMYFRFAQNTLGNKLFACGPDAKEV    491 - 560
RKENQANTSVV                                                               561 - 571
//

Text Mined References (139)

PMID Year Title
26666535 2016 Dysregulation of ferroportin gene expression in ?(0)-thalassemia/Hb E disease.
26437604 2015 Ironing out Ferroportin.
26125411 2015 Hepcidin-ferroportin axis controls toll-like receptor 4 dependent macrophage inflammatory responses in human atherosclerotic plaques.
25976471 2015 Hereditary hemochromatosis type 1 phenotype modifiers in Italian patients. The controversial role of variants in HAMP, BMP2, FTL and SLC40A1 genes.
25855377 2015 Decreased ferroportin promotes myeloma cell growth and osteoclast differentiation.
25805936 2015 Hepcidin/ferroportin expression levels involve efficacy of pegylated-interferon plus ribavirin in hepatitis C virus-infected liver.
25745821 2015 Bone marrow iron distribution, hepcidin, and ferroportin expression in renal anemia.
25744489 2015 Serum ferritin concentration is affected by ferroportin Q248H mutation in Africans.
25451081 2015 Disordered signaling governing ferroportin transcription favors breast cancer growth.
25441019 2015 [Usefulness of a diagnostic algorithm hyperferritinemia: A case report of a Spanish family with hereditary hemochromatosis and mutation in SLC40A1 gene].
More...