Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
Funding $93,472.5
PubMed Score 15.61
PubTator Score 19.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.600 0.016
osteosarcoma 1.224 0.002
medulloblastoma -1.900 0.002
cystic fibrosis 1.715 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
glioblastoma -1.900 0.006
medulloblastoma, large-cell -2.900 0.001
primitive neuroectodermal tumor -1.900 0.030
pediatric high grade glioma -1.500 0.005
lung carcinoma 1.300 0.000
invasive ductal carcinoma -2.000 0.000
ovarian cancer -3.200 0.000
pituitary cancer 2.900 0.000

Synonym

Accession Q9NP56 Q5W154
Symbols bA472E5.1

Gene

PANTHER Protein Class (2)

 Grant Application (2)

PDB

1LXW  

Gene RIF (11)

PMID Text
23453122 higher expression of PDE7B might be a novel unfavorable prognostic indicator in MCL, which possess important clinical significance.
21796143 The low frequency of this 5' untranslated region variant indicates that it does not explain the higher PDE7B expression in patients with chronic lymphocytic leukemia (CLL) but it has the potential to influence other settings that involve a role for PDE7B.
21383644 Genetic variation in the phosphodiesterase 7B is associated with bioavailability of testosterone enanthate.
21362230 PDE7B mRNA expression is obviously higher in mantle cell lymphoma patients compared with normal controls and significantly correlates with unfavorable cytogenetic characteristics.
21120911 High PDE7B is associated with chronic lymphocytic leukemia.
20798984 As a first exploitation of this unique cohort, we identify three novel candidate dyslexia genes, ZNF280D and TCF12 at 15q21, and PDE7B at 6q23.3, by molecular mapping of the familial translocation with the 15q21 breakpoint.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYSGEIGTKKKVK      1 - 70
RLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFN     71 - 140
THGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAA    141 - 210
AAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLIL    211 - 280
ATDINRQNEFLTRLKAHLHNKDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGE    281 - 350
LEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQ    351 - 420
HRSRGSSGSGPDHDHAGQGTESEEQEGDSP                                            421 - 450
//

Text Mined References (21)

PMID Year Title
24002674 2014 Genome-wide association study and meta-analysis of intraocular pressure.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23453122 2013 High expression of cyclic nucleotide phosphodiesterase 7B mRNA predicts poor prognosis in mantle cell lymphoma.
21796143 2011 Genetic variation in phosphodiesterase (PDE) 7B in chronic lymphocytic leukemia: overview of genetic variants of cyclic nucleotide PDEs in human disease.
21383644 2011 Bioavailability of testosterone enanthate dependent on genetic variation in the phosphodiesterase 7B but not on the uridine 5'-diphospho-glucuronosyltransferase (UGT2B17) gene.
21362230 2011 [Expression of cyclic nucleotide phosphodiesterase 7B in patients with mantle cell lymphoma and its prognostic significance].
21120911 2011 Cyclic nucleotide phosphodiesterase 7B mRNA: an unfavorable characteristic in chronic lymphocytic leukemia.
20798984 2011 A cohort of balanced reciprocal translocations associated with dyslexia: identification of two putative candidate genes at DYX1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20558539 2010 Common genetic variants associate with serum phosphorus concentration.
More...