Property Summary

Ligand Count 17
NCBI Gene PubMed Count 20
PubMed Score 14.73
PubTator Score 19.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.600 1.6e-02
atypical teratoid / rhabdoid tumor -2.600 1.1e-06
cystic fibrosis 1.715 7.6e-05
glioblastoma -1.900 5.9e-03
group 3 medulloblastoma -1.900 1.7e-02
invasive ductal carcinoma -2.000 2.3e-04
lung carcinoma 1.300 7.0e-10
medulloblastoma, large-cell -2.900 1.3e-03
osteosarcoma 1.224 1.6e-03
ovarian cancer -3.200 4.6e-13
pediatric high grade glioma -1.500 5.4e-03
pituitary cancer 1.200 1.7e-03
primitive neuroectodermal tumor -1.900 3.0e-02

Synonym

Accession Q9NP56 Q5W154
Symbols bA472E5.1

Gene

PDB

1LXW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

AA Sequence

MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYSGEIGTKKKVK      1 - 70
RLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFN     71 - 140
THGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAA    141 - 210
AAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLIL    211 - 280
ATDINRQNEFLTRLKAHLHNKDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGE    281 - 350
LEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQ    351 - 420
HRSRGSSGSGPDHDHAGQGTESEEQEGDSP                                            421 - 450
//

Text Mined References (22)

PMID Year Title