Property Summary

NCBI Gene PubMed Count 70
PubMed Score 174.80
PubTator Score 122.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
diabetes mellitus 1.100 1.3e-03
head and neck cancer -2.200 4.7e-02
head and neck cancer and chronic obstruc... -2.500 1.8e-02
lung adenocarcinoma 1.100 7.0e-03
lung carcinoma 3.000 1.2e-07
medulloblastoma, large-cell 1.300 1.1e-05
non-small cell lung cancer 1.525 7.7e-04
osteosarcoma 1.383 2.4e-06
ovarian cancer 1.300 3.0e-11
pituitary cancer -1.700 1.9e-02

Gene RIF (56)

AA Sequence

MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILEN      1 - 70
LPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ     71 - 140
VNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGI    141 - 210
LNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV                            211 - 256
//

Text Mined References (71)

PMID Year Title