Property Summary

NCBI Gene PubMed Count 68
Grant Count 28
R01 Count 18
Funding $2,563,950.21
PubMed Score 158.57
PubTator Score 122.42

Knowledge Summary

Patent

No data available

Gene RIF (54)

PMID Text
26658012 These studies identify the role of SPLUNC1 in sinonasal innate immunity and the pathogenesis of CRS. Defective expression of SPLUNC1 in CRSwNP patients may lead to insufficient maintenance of the epithelial barrier function
26559477 PLUNC is a protein of the tear film and suggest that it plays a role in fluid balance and surface tension regulation at the ocular surface.
26090599 High serum SPLUNC1 levels are associated with Pleural Effusion from Lung Cancer Compared to Tuberculosis.
25891128 SPLUNC1 can weaken the inflammatory response induced by EBV infection in NPC cells through the regulation of the TLR9/NF-kappaB signaling pathway and control of the tumor inflammatory microenvironment
25600649 LUNX silencing disrupted primary tumor growth, local invasion, and metastatic colonization
25574903 The G allele of rs1078761 may be detrimental to lung function in cystic fibrosis owing to decreased levels of BPIFA1 and BPIFB1.
25425729 pleural fluid LUNX mRNA provided a valuable adjunct in distinguishing malignant pleural effusion caused by lung cancer from benign pleural effusion
25223608 discoveries provide insight into the specific determinants governing the interaction between SPLUNC1 and lipids and also shed light on novel functions that SPLUNC1 and other PLUNC family members perform in host defense
25161098 12 retinoid X receptors heterodimer binding sites exist in the SPLUNC1 promoter region, which is up-regulated by all-trans-retinoic acid. SPLUNC1 plays a role in ATRA-induced growth inhibition and differentiation in nasopharyngeal carcinoma cells.
25136695 The observations suggest that, in response to agents or chemical factors, nasal mucosal epithelium will react and produce PLUNC proteins
More...

AA Sequence

MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILEN      1 - 70
LPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ     71 - 140
VNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGI    141 - 210
LNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV                            211 - 256
//

Text Mined References (69)

PMID Year Title
26658012 2016 Differential short palate, lung, and nasal epithelial clone 1 suppression in eosinophilic and noneosinophilic chronic rhinosinusitis with nasal polyps: implications for pathogenesis and treatment.
26559477 2015 Palate Lung Nasal Clone (PLUNC), a Novel Protein of the Tear Film: Three-Dimensional Structure, Immune Activation, and Involvement in Dry Eye Disease (DED).
26090599 2015 SPLUNC1 Is a Significant Marker in Pleural Effusion from Lung Cancer Compared to Tuberculosis.
25891128 2015 SPLUNC1 reduces the inflammatory response of nasopharyngeal carcinoma cells infected with the EB virus by inhibiting the TLR9/NF-?B pathway.
25600649 2015 Targeting LUNX inhibits non-small cell lung cancer growth and metastasis.
25574903 2015 Polymorphisms associated with expression of BPIFA1/BPIFB1 and lung disease severity in cystic fibrosis.
25425729 2014 Diagnostic utility of LUNX mRNA and VEGF mRNA in pleural fluid for differentiating benign from malignant origin.
25416956 2014 A proteome-scale map of the human interactome network.
25223608 2014 Structural characterization of the pulmonary innate immune protein SPLUNC1 and identification of lipid ligands.
25161098 2014 SPLUNC1 is associated with nasopharyngeal carcinoma prognosis and plays an important role in all-trans-retinoic acid-induced growth inhibition and differentiation in nasopharyngeal cancer cells.
More...