Property Summary

NCBI Gene PubMed Count 35
PubMed Score 41.62
PubTator Score 39.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.99490392844216E-110
ovarian cancer 8492 2.0182839379129E-9
tuberculosis and treatment for 6 months 686 4.30424911332548E-5
medulloblastoma, large-cell 6234 4.47205712516167E-5
cutaneous lupus erythematosus 1056 4.222575984723E-4
interstitial cystitis 2299 0.00113662422355965
lung cancer 4473 0.0018514245393124
Disease Target Count Z-score Confidence
Chronic inflammatory demyelinating polyradiculoneuropathy 5 3.947 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 0.000
medulloblastoma, large-cell 1.500 0.000
tuberculosis and treatment for 6 months -1.900 0.000
lung cancer -1.100 0.002
interstitial cystitis 1.100 0.001
ovarian cancer 1.100 0.000
psoriasis 2.400 0.000

Synonym

Accession Q9NP31 O43817 Q5UBZ1 Q5VZS4 Q5VZS5 Q9UPA7
Symbols SCAP
TSAD
VRAP
F2771

Gene

  Ortholog (7)

Gene RIF (20)

PMID Text
26163016 TSAD binds to and co-localizes with Nck. Expression of TSAD increases both Nck-Lck and Nck-SLP-76 interaction in T cells.
25492967 The kinase Itk and the adaptor TSAd change the specificity of the kinase Lck in T cells by promoting the phosphorylation of Tyr192.
24910151 Data indicate the expression pattern of T cell-specific adapter protein (TSAd) in various healthy lymphoid and non-lymphoid tissues.
21696499 in chronic inflammatory demyelinating polyneuropathy we found an association with a homozygous genotype for a low repeat number of tandem GA in the SH2D2A gene
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20305788 TSAd, through its interaction with both Itk and Lck, primes Itk for Lck mediated phosphorylation and thereby regulates CXCL12 induced T cell migration and actin cytoskeleton rearrangements
19913121 Observational study of gene-disease association. (HuGE Navigator)
19561400 TSAd associates with laminin binding protein and mediates T lymphocyte migration during T cell activation
19240061 Observational study of gene-disease association. (HuGE Navigator)
18554728 the present study shows that the SH2D2A gene may contribute to susceptibility to MS.
More...

AA Sequence

MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAEEVPGEGSLFL      1 - 70
QAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRH     71 - 140
FLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQ    141 - 210
DPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIY    211 - 280
NEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ    281 - 350
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ                                   351 - 389
//

Text Mined References (36)

PMID Year Title
26163016 2015 T cell specific adaptor protein (TSAd) promotes interaction of Nck with Lck and SLP-76 in T cells.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25492967 2014 The kinase Itk and the adaptor TSAd change the specificity of the kinase Lck in T cells by promoting the phosphorylation of Tyr192.
25416956 2014 A proteome-scale map of the human interactome network.
24910151 2014 Expression of the T cell-specific adapter protein in human tissues.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
21696499 2011 Polymorphism of CD1 and SH2D2A genes in inflammatory neuropathies.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20305788 2010 T cell specific adapter protein (TSAd) interacts with Tec kinase ITK to promote CXCL12 induced migration of human and murine T cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...