Property Summary

NCBI Gene PubMed Count 36
PubMed Score 42.40
PubTator Score 39.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 4.2e-04
interstitial cystitis 1.100 1.1e-03
lung cancer -1.100 1.9e-03
medulloblastoma, large-cell 1.500 4.5e-05
ovarian cancer 1.100 2.0e-09
psoriasis 2.400 2.0e-110
tuberculosis -1.400 1.2e-05

Protein-protein Interaction (2)

Gene RIF (21)

AA Sequence

MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAEEVPGEGSLFL      1 - 70
QAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRH     71 - 140
FLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQ    141 - 210
DPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIY    211 - 280
NEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ    281 - 350
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ                                   351 - 389
//

Text Mined References (37)

PMID Year Title