Property Summary

NCBI Gene PubMed Count 7
PubMed Score 100.63
PubTator Score 88.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
facioscapulohumeral dystrophy 2.200 5.1e-03
malignant mesothelioma 1.100 6.3e-05
non primary Sjogren syndrome sicca 1.200 1.7e-02

Gene RIF (3)

AA Sequence

MPDELTEPGRATPARASSFLIENLLAAEAKGAGRATQGDGSREDEEEDDDDPEDEDAEQARRRRLQRRRQ      1 - 70
LLAGTGPGGEARARALLGPGALGLGPRPPPGPGPPFALGCGGAARWYPRAHGGYGGGLSPDTSDRDSPET     71 - 140
GEEMGRAEGAWPRGPGPGAVQREAAELAARGPAAGTEEASELAEVPAAAGETRGGVGVGGGRKKKTRTVF    141 - 210
SRSQVFQLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELEAASLSPPGAQRLV    211 - 280
RVPVLYHESPPAAAAAGPPATLPFPLAPAAPAPPPPLLGFSGALAYPLAAFPAAASVPFLRAQMPGLV      281 - 348
//

Text Mined References (8)

PMID Year Title