Property Summary

NCBI Gene PubMed Count 7
Grant Count 38
R01 Count 21
Funding $3,154,597.18
PubMed Score 96.29
PubTator Score 88.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
non primary Sjogren syndrome sicca 1.200 0.017
facioscapulohumeral dystrophy 2.200 0.005

Gene RIF (3)

PMID Text
21417677 The retinal degeneration in the recessively inherited oculo-auricular syndrome is a progressive rod-cone dystrophy.
18976975 Knockdown of H6 family homeobox 1 (HMX1) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
18423520 Linkage analysis and mutation screening revealed in the first exon of the NKX5-3 gene a homozygous 26 nucleotide deletion, generating a truncating protein that lacked the complete homeodomain.

AA Sequence

MPDELTEPGRATPARASSFLIENLLAAEAKGAGRATQGDGSREDEEEDDDDPEDEDAEQARRRRLQRRRQ      1 - 70
LLAGTGPGGEARARALLGPGALGLGPRPPPGPGPPFALGCGGAARWYPRAHGGYGGGLSPDTSDRDSPET     71 - 140
GEEMGRAEGAWPRGPGPGAVQREAAELAARGPAAGTEEASELAEVPAAAGETRGGVGVGGGRKKKTRTVF    141 - 210
SRSQVFQLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELEAASLSPPGAQRLV    211 - 280
RVPVLYHESPPAAAAAGPPATLPFPLAPAAPAPPPPLLGFSGALAYPLAAFPAAASVPFLRAQMPGLV      281 - 348
//

Text Mined References (8)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21417677 2011 Retinal dystrophy in the oculo-auricular syndrome due to HMX1 mutation.
18423520 2008 Mutation in the human homeobox gene NKX5-3 causes an oculo-auricular syndrome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10206974 1999 Transcriptional antagonism between Hmx1 and Nkx2.5 for a shared DNA-binding site.
7647458 1995 Phylogenetic conservation and physical mapping of members of the H6 homeobox gene family.
1360670 1992 Identification and genetic mapping of a homeobox gene to the 4p16.1 region of human chromosome 4.