Property Summary

NCBI Gene PubMed Count 7
PubMed Score 96.29
PubTator Score 88.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
non primary Sjogren syndrome sicca 1.200 0.017
facioscapulohumeral dystrophy 2.200 0.005

Synonym

Accession Q9NP08
Symbols H6
NKX5-3

Gene

  Ortholog (7)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Xenopus EggNOG Inparanoid

Gene RIF (3)

PMID Text
21417677 The retinal degeneration in the recessively inherited oculo-auricular syndrome is a progressive rod-cone dystrophy.
18976975 Knockdown of H6 family homeobox 1 (HMX1) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
18423520 Linkage analysis and mutation screening revealed in the first exon of the NKX5-3 gene a homozygous 26 nucleotide deletion, generating a truncating protein that lacked the complete homeodomain.

AA Sequence

MPDELTEPGRATPARASSFLIENLLAAEAKGAGRATQGDGSREDEEEDDDDPEDEDAEQARRRRLQRRRQ      1 - 70
LLAGTGPGGEARARALLGPGALGLGPRPPPGPGPPFALGCGGAARWYPRAHGGYGGGLSPDTSDRDSPET     71 - 140
GEEMGRAEGAWPRGPGPGAVQREAAELAARGPAAGTEEASELAEVPAAAGETRGGVGVGGGRKKKTRTVF    141 - 210
SRSQVFQLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELEAASLSPPGAQRLV    211 - 280
RVPVLYHESPPAAAAAGPPATLPFPLAPAAPAPPPPLLGFSGALAYPLAAFPAAASVPFLRAQMPGLV      281 - 348
//

Text Mined References (8)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21417677 2011 Retinal dystrophy in the oculo-auricular syndrome due to HMX1 mutation.
18423520 2008 Mutation in the human homeobox gene NKX5-3 causes an oculo-auricular syndrome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10206974 1999 Transcriptional antagonism between Hmx1 and Nkx2.5 for a shared DNA-binding site.
7647458 1995 Phylogenetic conservation and physical mapping of members of the H6 homeobox gene family.
1360670 1992 Identification and genetic mapping of a homeobox gene to the 4p16.1 region of human chromosome 4.