Property Summary

NCBI Gene PubMed Count 6
Grant Count 4
R01 Count 4
Funding $296,958.34
PubMed Score 13.98
PubTator Score 11.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Gene RIF (2)

PMID Text
19602509 Mutations in the protamine locus may be an infrequent cause of male infertility.
19602509 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSRCAKLNTGQSPGHSPGHSTGHGRGHESSMKKLMACVSQDNFSLSSAGEEEEEEEEEGEEEEKEELPV      1 - 70
QGKLLLLEPERQEEGQKDNAEAQQSPEPKQTPS                                          71 - 103
//

Text Mined References (6)

PMID Year Title
23568457 2013 Genetic variants associated with disordered eating.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
19602509 2009 Mutations in the protamine locus: association with spermatogenic failure?
16581810 Protamines and male infertility.
9827065 1998 Genesis of a novel human sequence from the protamine PRM1 gene.
8720108 1996 Sequence analysis of the conserved protamine gene cluster shows that it contains a fourth expressed gene.