Property Summary

NCBI Gene PubMed Count 6
PubMed Score 14.26
PubTator Score 11.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (2)

AA Sequence

MGSRCAKLNTGQSPGHSPGHSTGHGRGHESSMKKLMACVSQDNFSLSSAGEEEEEEEEEGEEEEKEELPV      1 - 70
QGKLLLLEPERQEEGQKDNAEAQQSPEPKQTPS                                          71 - 103
//

Text Mined References (6)

PMID Year Title