Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.61
PubTator Score 1.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.200 4.1e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.5e-02
osteosarcoma -1.053 1.8e-04
ovarian cancer 1.700 2.6e-05

Synonym

Accession Q9NNZ3 O14716
Symbols HSPF2
MCG18
DANJC4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNP      1 - 70
SLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRP     71 - 140
QGPQLRQQQHKQNKQVLGYCLLLMLAGMGLHYIAFRKVKQMHLNFMDEKDRIITAFYNEARARARANRGI    141 - 210
LQQERQRLGQRQPPPSEPTQGPEIVPRGAGP                                           211 - 241
//

Text Mined References (10)

PMID Year Title