Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.92
PubTator Score 10.14

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
19812318 We demonstrate that VCX-A can specifically bind a subset of mRNAs involved in neuritogenesis and is also capable of promoting translational silencing.
18076704 two different deletion patterns were observed: the first group included 62 patients with deletion of VCX3A & VCX genes. The second group included 18 patients with breakpoints at several regions on either side of the STS gene not including the VCX3A gene.
17157254 Our data demonstrate that VCX-A can regulate mRNA stability and that it is an example of a tissue-specific decapping regulator.

AA Sequence

MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEV     71 - 140
EEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSV                            141 - 186
//

Text Mined References (10)

PMID Year Title
19812318 2009 Modulation of neuritogenesis by a protein implicated in X-linked mental retardation.
18076704 2008 Analysis of the VCX3A, VCX2 and VCX3B genes shows that VCX3A gene deletion is not sufficient to result in mental retardation in X-linked ichthyosis.
17157254 2006 Identification of an mRNA-decapping regulator implicated in X-linked mental retardation.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10903929 2000 A member of a gene family on Xp22.3, VCX-A, is deleted in patients with X-linked nonspecific mental retardation.
10607842 2000 A human sex-chromosomal gene family expressed in male germ cells and encoding variably charged proteins.
1549475 1992 Characterization of a low copy repetitive element S232 involved in the generation of frequent deletions of the distal short arm of the human X chromosome.