Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.93
PubTator Score 10.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NNX9 Q9P0H4
Symbols VCX3
VCXA
VCX-A
VCX8R
VCX-8r

Gene

Gene RIF (3)

AA Sequence

MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEV     71 - 140
EEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSV                            141 - 186
//

Text Mined References (10)

PMID Year Title