Property Summary

NCBI Gene PubMed Count 296
PubMed Score 714.53
PubTator Score 353.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer -1.800 2.4e-02
ductal carcinoma in situ -1.500 3.3e-03
interstitial cystitis 1.600 1.6e-03
intraductal papillary-mucinous adenoma (... -1.100 2.6e-03
intraductal papillary-mucinous neoplasm ... -1.300 8.5e-03
invasive ductal carcinoma -2.000 4.2e-03
lung cancer 2.100 2.4e-04

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (417)

AA Sequence

MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQE      1 - 70
QSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEK     71 - 140
SKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKS    141 - 210
KQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDS    211 - 280
ITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNN    281 - 350
VGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA                    351 - 404
//

Text Mined References (309)

PMID Year Title