Property Summary

NCBI Gene PubMed Count 279
Grant Count 320
R01 Count 158
Funding $38,880,656.08
PubMed Score 689.73
PubTator Score 353.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Gene

PDB

1K9I   1SL4   1SL5   2B6B   2IT5   2IT6   2XR5   2XR6  

Gene RIF (459)

PMID Text
26722430 CD209 gene -871A/G is associated with decreased susceptibility to pulmonary tuberculosis (PT) overall; -336A/G polymorphism is associated with increased susceptibility in Asians and -139G/A polymorphism is not associated with susceptibility to PT
26629951 The high-mannose N-linked glycan at N154 of Japanese encephalitis virus E glycoprotein was shown to be crucial for binding to DC-SIGN and subsequent internalization.
26398832 Preliminary study suggests that OAS gene cluster and CD209 gene polymorphisms influence the risk of developing clinical symptoms in Chikungunya virus-infected patients.
26272216 M2 macrophages induced a DC-SIGN-dependent adhesion of highly mannosylated IgM(+) FL B cells and triggered BCR-associated kinase activation.
26194765 Engagement of sIg in FL cells or normal B cells by anti-Ig led to endocytosis in vitro as expected, but DC-SIGN, even when cross-linked, did not lead to significant endocytosis of sIg
26133046 DC-SIGN can promote the maturation and activation of dendritic cells on recognition of hepatitis B virus, but wild type virus can escape recognition by DC-SIGN to a certain extent with the help of demannosylated modification.
26106150 Data suggest that serum amyloid P (SAP) activates CD209 DC-SIGN to regulate the innate immune system differently from C-reactive protein (CRP), and that DC-SIGN is a target for antifibrotics.
26018157 HIV-1 Env gp120/41 (JRFL Env in the contaxt of HIV-Gag-GFP VLP) binds to CD209 (DC-SIGN) on the surface of basophils
25883525 Two SNPs of DC-SIGN (rs735239 and rs735240) were associated with susceptibility to fungal keratitis in the northern Han Chinese population.
25793526 Colorectal mucus can bind the C-type lectin DC-SIGN and block HIV-1 trans-infection of both CCR5 and CXCR4 using HIV-1 strains.
More...

AA Sequence

MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQE      1 - 70
QSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEK     71 - 140
SKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKS    141 - 210
KQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDS    211 - 280
ITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNN    281 - 350
VGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA                    351 - 404
//

Text Mined References (292)

PMID Year Title
26722430 2015 The association between CD209 gene polymorphisms and pulmonary tuberculosis susceptibility: a meta-analysis.
26629951 2016 DC-SIGN as an attachment factor mediates Japanese encephalitis virus infection of human dendritic cells via interaction with a single high-mannose residue of viral E glycoprotein.
26398832 2016 Association of Oligoadenylate Synthetase Gene Cluster and DC-SIGN (CD209) Gene Polymorphisms with Clinical Symptoms in Chikungunya Virus Infection.
26272216 2015 DC-SIGN-expressing macrophages trigger activation of mannosylated IgM B-cell receptor in follicular lymphoma.
26194765 2015 Lectin binding to surface Ig variable regions provides a universal persistent activating signal for follicular lymphoma cells.
26133046 Role of Dendritic Cell-Specific ICAM-3-Grabbing Nonintegrin on Dendritic Cells in the Recognition of Hepatitis B Virus.
26106150 2015 DC-SIGN activation mediates the differential effects of SAP and CRP on the innate immune system and inhibits fibrosis in mice.
25883525 2015 Association of Dectin-1 and DC-SIGN gene single nucleotide polymorphisms with fungal keratitis in the northern Han Chinese population.
25793526 2015 Colorectal mucus binds DC-SIGN and inhibits HIV-1 trans-infection of CD4+ T-lymphocytes.
25679217 2015 Porphyromonas gingivalis evasion of autophagy and intracellular killing by human myeloid dendritic cells involves DC-SIGN-TLR2 crosstalk.
More...