Property Summary

NCBI Gene PubMed Count 20
PubMed Score 26.89
PubTator Score 25.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.90619900350223E-10
malignant mesothelioma 3163 1.01394220247028E-7
ovarian cancer 8492 1.19492866322228E-6
tuberculosis 1563 4.97957901102288E-6
pancreatic cancer 2300 2.56221213668331E-5
interstitial cystitis 2299 3.27242271528671E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.51851466390185E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00121267059019165
medulloblastoma, large-cell 6234 0.00202503242459267
adult high grade glioma 2148 0.00253165383656953
glioblastoma 5572 0.0051666434854513
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00691977571429426
adrenocortical carcinoma 1427 0.00869228032967668
invasive ductal carcinoma 2950 0.00949678103213646
astrocytic glioma 2241 0.0168013499264021
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0207106703562699
oligodendroglioma 2849 0.0317691427762952
spina bifida 1064 0.035817889435841
Disease Target Count Z-score Confidence
Amelogenesis imperfecta 26 5.871 2.9
Tooth erosion 5 3.575 1.8
Dental caries 67 3.041 1.5

Expression

Synonym

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Pathway (1)

Gene RIF (6)

PMID Text
25373699 the statistically significant association of rs2337359 upstream of TUFT1 with dental caries experience via meta-analysis across adult samples (p < 0.002) and the suggestive association for multiple variants in TFIP11 across child samples
23790503 We found evidence for a trend of association between genetic variation of TUFT1 and TFIP11 and MIH, which suggest these genes are potentially involved in individual predisposition to MIH.
18781068 The CT genotype of the tuftelin rs3790506 marker was overrepresented in cases with dmft scores higher than 5 and dmfs scores higher than 6 compared to controls.
18781068 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12489194 The human tuftelin gene and the expression of tuftelin in mineralizing and nonmineralizing tissues. Review.
11733143 Human tuftelin gene contains 13 exons and is larger than 26 kb, with two alternatively spliced tuftelin mRNA transcripts now been identified in the human tooth bud.

AA Sequence

MNGTRNWCTLVDVHPEDQAAGSVDILRLTLQGELTGDELEHIAQKAGRKTYAMVSSHSAGHSLASELVES      1 - 70
HDGHEEIIKVYLKGRSGDKMIHEKNINQLKSEVQYIQEARNCLQKLREDISSKLDRNLGDSLHRQEIQVV     71 - 140
LEKPNGFSQSPTALYSSPPEVDTCINEDVESLRKTVQDLLAKLQEAKRQHQSDCVAFEVTLSRYQREAEQ    141 - 210
SNVALQREEDRVEQKEAEVGELQRRLLGMETEHQALLAKVREGEVALEELRSNNADCQAEREKAATLEKE    211 - 280
VAGLREKIHHLDDMLKSQQRKVRQMIEQLQNSKAVIQSKDATIQELKEKIAYLEAENLEMHDRMEHLIEK    281 - 350
QISHGNFSTQARAKTENPGSIRISKPPSPKPMPVIRVVET                                  351 - 390
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25373699 2015 Effects of enamel matrix genes on dental caries are moderated by fluoride exposures.
23790503 2013 Genes expressed in dental enamel development are associated with molar-incisor hypomineralization.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18781068 2008 Enamel formation genes are associated with high caries experience in Turkish children.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...