Property Summary

NCBI Gene PubMed Count 22
PubMed Score 31.12
PubTator Score 25.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Protein-protein Interaction (6)

Gene RIF (8)

AA Sequence

MNGTRNWCTLVDVHPEDQAAGSVDILRLTLQGELTGDELEHIAQKAGRKTYAMVSSHSAGHSLASELVES      1 - 70
HDGHEEIIKVYLKGRSGDKMIHEKNINQLKSEVQYIQEARNCLQKLREDISSKLDRNLGDSLHRQEIQVV     71 - 140
LEKPNGFSQSPTALYSSPPEVDTCINEDVESLRKTVQDLLAKLQEAKRQHQSDCVAFEVTLSRYQREAEQ    141 - 210
SNVALQREEDRVEQKEAEVGELQRRLLGMETEHQALLAKVREGEVALEELRSNNADCQAEREKAATLEKE    211 - 280
VAGLREKIHHLDDMLKSQQRKVRQMIEQLQNSKAVIQSKDATIQELKEKIAYLEAENLEMHDRMEHLIEK    281 - 350
QISHGNFSTQARAKTENPGSIRISKPPSPKPMPVIRVVET                                  351 - 390
//

Text Mined References (24)

PMID Year Title