Property Summary

NCBI Gene PubMed Count 20
Grant Count 18
R01 Count 15
Funding $1,426,890.31
PubMed Score 26.89
PubTator Score 25.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25373699 the statistically significant association of rs2337359 upstream of TUFT1 with dental caries experience via meta-analysis across adult samples (p < 0.002) and the suggestive association for multiple variants in TFIP11 across child samples
23790503 We found evidence for a trend of association between genetic variation of TUFT1 and TFIP11 and MIH, which suggest these genes are potentially involved in individual predisposition to MIH.
18781068 The CT genotype of the tuftelin rs3790506 marker was overrepresented in cases with dmft scores higher than 5 and dmfs scores higher than 6 compared to controls.
18781068 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12489194 The human tuftelin gene and the expression of tuftelin in mineralizing and nonmineralizing tissues. Review.
11733143 Human tuftelin gene contains 13 exons and is larger than 26 kb, with two alternatively spliced tuftelin mRNA transcripts now been identified in the human tooth bud.

AA Sequence

MNGTRNWCTLVDVHPEDQAAGSVDILRLTLQGELTGDELEHIAQKAGRKTYAMVSSHSAGHSLASELVES      1 - 70
HDGHEEIIKVYLKGRSGDKMIHEKNINQLKSEVQYIQEARNCLQKLREDISSKLDRNLGDSLHRQEIQVV     71 - 140
LEKPNGFSQSPTALYSSPPEVDTCINEDVESLRKTVQDLLAKLQEAKRQHQSDCVAFEVTLSRYQREAEQ    141 - 210
SNVALQREEDRVEQKEAEVGELQRRLLGMETEHQALLAKVREGEVALEELRSNNADCQAEREKAATLEKE    211 - 280
VAGLREKIHHLDDMLKSQQRKVRQMIEQLQNSKAVIQSKDATIQELKEKIAYLEAENLEMHDRMEHLIEK    281 - 350
QISHGNFSTQARAKTENPGSIRISKPPSPKPMPVIRVVET                                  351 - 390
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25373699 2015 Effects of enamel matrix genes on dental caries are moderated by fluoride exposures.
23790503 2013 Genes expressed in dental enamel development are associated with molar-incisor hypomineralization.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18781068 2008 Enamel formation genes are associated with high caries experience in Turkish children.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...