Property Summary

NCBI Gene PubMed Count 51
Grant Count 128
R01 Count 84
Funding $12,364,612.72
PubMed Score 446.42
PubTator Score 84.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
osteosarcoma -1.023 0.000

Synonym

Accession Q9NNW7 O95840 Q96IJ2 Q9H2Z5 Q9NZV3 Q9NZV4 Q9P2Y0 Q9P2Y1 Q9UQU8
Symbols TR
TR3
SELZ
TRXR2
TR-BETA

Gene

PANTHER Protein Class (2)

PDB

1W1E  

Gene RIF (37)

PMID Text
26752265 A meta-analysis of the top SNPs identified three new associated loci in primary open angle glaucoma--TXNRD2, ATXN2, and FOXC1
26573231 Data suggest that TXNRD2 may represent a druggable target that could be deployed to reduce the development of fatal pulmonary metastases in patients with osteosarcoma (OS).
26469385 HIV-1 MA upregulates TXNRD2 (TR3) gene expression in HepG2 cells
25703281 The TXNRD2 rs 1548357 polymorphism might be a genetic risk factor for Myocardial infarction in subjects with T2 Diabetes mellitus of Slovenian origin.
24624337 Data suggest TXNRD1 and TXRNRD2 function at the top of a redox pyramid that governs the oxidation state of peroxiredoxins and other protein factors, thereby dictating a hierarchy of phenotypic responses to oxidative insults.
24601690 Absence of TXNRD2 in humans leads to glucocorticoid deficiency.
24058403 Single Nucleotide Polymorphisms in the genes GPX1 (rs1050450, rs1800668 and rs3811699), TrxR2 (rs5748469), and DIO2 (rs225014) may not be significantly associated with Kashin-Beck disease in a Tibetan population.
23597419 Development of subcutaneous fibrosis can be associated with genetic variation in the mitochondrial enzyme TXNRD2, critically involved in removal of ROS, and maintenance of the intracellular redox balance.
23063346 Data suggest that dietary factor (selenium supplementation) up-regulates endogenous antioxidant systems and protects trophoblasts from oxidative stress; selenium upregulates GPX1 (glutathione peroxidase 1) and thioredoxin reductases (TXNRD1; TXNRD2).
22683372 A role of GPx2, TrxR2 and TrxR3 in proliferation, apoptosis and, therefore, also during cancer development.
More...

AA Sequence

MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDY      1 - 70
VEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQPVPHDWRKMAEAVQNHVKSLN     71 - 140
WGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLSADHIIIATGGRPRYPTHIEGALEYGITSDD    141 - 210
IFWLKESPGKTLVVGASYVALECAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCA    211 - 280
PSRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATS    281 - 350
VPHIYAIGDVVEGRPELTPIAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHG    351 - 420
QEHVEVYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQV    421 - 490
MRTVGIHPTCSEEVVKLRISKRSGLDPTVTGCUG                                        491 - 524
//

Text Mined References (54)

PMID Year Title
26752265 2016 Genome-wide association analysis identifies TXNRD2, ATXN2 and FOXC1 as susceptibility loci for primary open-angle glaucoma.
26573231 2016 Auranofin is a potent suppressor of osteosarcoma metastasis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25703281 2015 Association of thioredoxin reductase 2 (TXNRD2) gene polymorphisms with myocardial infarction in Slovene patients with type 2 diabetes mellitus.
24847357 2014 Genome wide association study of SNP-, gene-, and pathway-based approaches to identify genes influencing susceptibility to Staphylococcus aureus infections.
24624337 2014 Resolution of oxidative stress by thioredoxin reductase: Cysteine versus selenocysteine.
24601690 2014 Thioredoxin Reductase 2 (TXNRD2) mutation associated with familial glucocorticoid deficiency (FGD).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24058403 2013 Association study of polymorphisms in selenoprotein genes and Kashin-Beck disease and serum selenium/iodine concentration in a Tibetan population.
23597419 2013 SNP in TXNRD2 associated with radiation-induced fibrosis: a study of genetic variation in reactive oxygen species metabolism and signaling.
More...