Knowledge Summary

Patent

No data available

AA Sequence

MIFAGKAPSNTSTLMKFYSLLLYSLLFSFPFLCHPLPLPSYLHHTINLTHSLLAASNPSLVNNCWLCISL      1 - 70
SSSAYTAVPAVQTDWATSPISLHLRTSFNSPHLYPPEELIYFLDRSSKTSPDISHQQAAALLRTYLKNLS     71 - 140
PYINSTPPIFGPLTTQTTIPVAAPLCISWQRPTGIPLGNLSPSRCSFTLHLRSPTTNINETIGAFQLHIT    141 - 210
DKPSINTDKLKNISSNYCLGRHLPCISLHPWLSSPCSSDSPPRPSSCLLIPSPENNSERLLVDTRRFLIH    211 - 280
HENRTFPSTQLPHQSPLQPLTAAALAGSLGVWVQDTPFSTPSHLFTLHLQFCLAQGLFFLCGSSTYMCLP    281 - 350
ANWTGTCTLVFLTPKIQFANGTEELPVPLMTPTQQKRVIPLIPLMVGLGLSASTVALGTGIAGISTSVMT    351 - 420
FRSLSNDFSASITDISQTLSVLQAQVDSLAAVVLQNRRGLDLLTAEKGGLCIFLNEECCFYLNQSGLVYD    421 - 490
NIKKLKDRAQKLANQASNYAEPPWALSNWMSWVLPIVSPLIPIFLLLLFGPCIFRLVSQFIQNRIQAITN    491 - 560
HSIRQMFLLTSPQYHPLPQDLPSA                                                  561 - 584
//

Text Mined References (6)

PMID Year Title
14557543 2003 Genomewide screening for fusogenic human endogenous retrovirus envelopes identifies syncytin 2, a gene conserved on primate evolution.
12970426 2003 Survey of human genes of retroviral origin: identification and transcriptome of the genes with coding capacity for complete envelope proteins.
12079564 2002 Full-length HERV-H elements with env SU open reading frames in the human genome.
11562544 2001 The full-length envelope of an HERV-H human endogenous retrovirus has immunosuppressive properties.
11162811 2001 Characterization of the three HERV-H proviruses with an open envelope reading frame encompassing the immunosuppressive domain and evolutionary history in primates.
10366582 1999 Isolation of a human endogenous retroviral HERV-H element with an open env reading frame.