Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.25
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.426 5.6e-08
autosomal dominant Emery-Dreifuss muscul... 1.112 8.6e-04
dermatomyositis 1.100 3.4e-04
diabetes mellitus -1.100 1.2e-02
esophageal adenocarcinoma 1.100 1.8e-02
Multiple myeloma 1.144 9.6e-05
osteosarcoma -1.781 5.6e-07
ovarian cancer -1.300 3.0e-04
pancreatic ductal adenocarcinoma liver m... -2.274 5.5e-04
psoriasis -1.400 2.8e-05
subependymal giant cell astrocytoma -1.137 3.7e-03

Gene RIF (4)

AA Sequence

MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLESPIDPQPL      1 - 70
SFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPC     71 - 140
KTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGR    141 - 210
KIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMAR    211 - 280
IRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFS    281 - 350
QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV        351 - 416
//

Text Mined References (25)

PMID Year Title