Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.04
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q9HDC9 A8K514 B4DXG1 Q6UVZ8 Q9GZS8 Q9NUB2
Symbols BSCv
C20orf3

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
25180020 APMAP is an endogenous suppressor of Abeta production in the brain.
22267596 C20orf3 mapping at chromosome 20p11 is associated with hepatic-specific metastasis in patients with colorectal cancer.
18513186 characterization of the gene product of open reading frame 3 encoded at human chromosome 20 (C20orf3), which represents a member of the lactonohydrolase super family

AA Sequence

MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLESPIDPQPL      1 - 70
SFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPC     71 - 140
KTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGR    141 - 210
KIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMAR    211 - 280
IRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFS    281 - 350
QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV        351 - 416
//

Text Mined References (24)

PMID Year Title
26767403 2016 Identification of a Novel Function of Adipocyte Plasma Membrane-Associated Protein (APMAP) in Gestational Diabetes Mellitus by Proteomic Analysis of Omental Adipose Tissue.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25180020 2015 The adipocyte differentiation protein APMAP is an endogenous suppressor of A? production in the brain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22267596 2013 Chromosome 20p11 gains are associated with liver-specific metastasis in patients with colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
20552250 2010 Reconstruction of gene association network reveals a transmembrane protein required for adipogenesis and targeted by PPAR?.
More...