Property Summary

NCBI Gene PubMed Count 15
PubMed Score 56.20
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.670 7.1e-03
active ulcerative colitis 1.409 8.0e-03
adult high grade glioma -2.700 9.6e-05
astrocytic glioma -2.600 1.0e-03
Astrocytoma, Pilocytic -1.900 8.3e-05
atypical teratoid / rhabdoid tumor -3.500 4.5e-08
ependymoma -2.600 2.1e-03
glioblastoma -2.300 9.6e-06
group 3 medulloblastoma -2.700 1.1e-03
interstitial cystitis -1.400 5.5e-03
interstitial lung disease -1.200 2.9e-02
invasive ductal carcinoma 1.300 4.4e-02
lung adenocarcinoma -1.100 1.2e-08
medulloblastoma, large-cell 1.300 3.9e-03
oligodendroglioma -2.600 3.1e-03
primitive neuroectodermal tumor -2.800 1.6e-06
subependymal giant cell astrocytoma -2.040 3.3e-02
urothelial carcinoma -2.100 3.0e-04

Gene RIF (5)

AA Sequence

MTGGRFDFDDGGTYCGGWEEGKAHGHGICTGPKGQGEYSGSWSHGFEVVGGYTWPSGNTYQGYWAQGKRH      1 - 70
GLGVETKGKWMYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGVETYGDGGTYQGQWAGGMRHG     71 - 140
YGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHDAAAAADSPAGTRGGFVLNFHADAELAGKKKGG    141 - 210
LFRRGSLLGSMKLRKSESKSSISSKRSSVRSDAAMSRISSSDANSTISFGDVDCDFCPVEDHVDATTTET    211 - 280
YMGEWKNDKRNGFGVSERSNGMKYEGEWANNKRHGYGCTVFPDGSKEEGKYKNNILVRGIRKQLIPIRHT    281 - 350
KTREKVDRAIEGAQRAAAMARTKVEIANSRTAHARAKADAADQAALAARQECDIARAVARELSPDFYQPG    351 - 420
PDYVKQRFQEGVDAKENPEEKVPEKPPTPKESPHFYRKGTTPPRSPEASPKHSHSPASSPKPLKKQNPSS    421 - 490
GARLNQDKRSVADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAP    491 - 560
QHPPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTKPVAKESKAEPKAKKSELAIPKNPASNDSCPALE    561 - 630
KEANSGPNSIMIVLVMLLNIGLAILFVHFLT                                           631 - 661
//

Text Mined References (20)

PMID Year Title