Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q9HDB8
Symbols ERVK5
HERV-KII
HERV-K(II)

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MVTPVTWMDNPIEVYVNDSVWVPGPTDDRCPAKPEEEGMMINISIVYRYPPICLGRAPGCLMPAVQNWLV      1 - 70
EVPTVSPNSRFTYHMVSGMSLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSA     71 - 140
VILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLDKHKHKKLQSFYPWEWGEKGIS    141 - 210
TPRPEIISPVSGPEHPELWRLWPDTTLEFGLEIKL                                       211 - 245
//

Text Mined References (5)

PMID Year Title