Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary


No data available


Accession Q9HDB8
Symbols ERVK5


 GO Component (1)

 Compartment GO Term (0)

AA Sequence

TPRPEIISPVSGPEHPELWRLWPDTTLEFGLEIKL                                       211 - 245

Publication (5)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
12629516 2003 Quantitation of HERV-K env gene expression and splicing in human breast cancer.
12060620 2002 A novel gene from the human endogenous retrovirus K expressed in transformed cells.
11401426 2001 Transcriptionally active HERV-K genes: identification, isolation, and chromosomal mapping.
7983737 1995 Human endogenous retrovirus K10: expression of Gag protein and detection of antibodies in patients with seminomas.