Property Summary

NCBI Gene PubMed Count 6
PubMed Score 11.66
PubTator Score 6.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 6.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Congenital stationary night blindness 29 3.268 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 2.000 6.6e-04

Gene RIF (2)

AA Sequence

MSKTFVKSKEMGELVNTPSWMDKGLGSQNEVKEEESRPGTYGMLSSLTEEHDSIEEEEEEEEDGEKPKRR      1 - 70
GPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALS     71 - 140
EVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQSVLLEKHEDKSPICDSAISVHNFNYQSPGLP    141 - 210
SPPYGHMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFM    211 - 280
PHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHGIGTQLNTVFTE                       281 - 331
//

Text Mined References (8)

PMID Year Title