Property Summary

NCBI Gene PubMed Count 445
Grant Count 232
R01 Count 110
Funding $29,455,173.91
PubMed Score 1235.28
PubTator Score 713.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
gastric cancer -1.800 0.029
osteosarcoma -3.283 0.000
non-small cell lung cancer -1.609 0.000
lung adenocarcinoma -1.384 0.000
COPD -1.100 0.011

Synonym

Accession Q9HD89 D6W649 Q540D9 Q76B53
Symbols ADSF
RSTN
XCP1
FIZZ3
RETN1

Gene

PDB

1LV6  

 GO Function (1)

Gene RIF (461)

PMID Text
27214983 The inverse correlation between resistin levels and the level of IGF-1 in plasma confirms the existing relationship between their productions.
26967765 revealed increased likelihood of metabolic and dyslipidemic manifestations in obese compared to non-obese PCOS patients, while no significant difference was noted in visfatin and resistin levels among PCOS patients in terms of co-morbid obesity and in comparison to controls
26690142 Resistin can initiate the endothelial adhesion of colorectal cancer cells, with concomitant increases in NF-kappaB activity and ICAM-1 and VCAM-1 expression.
26509463 Serum levels of resistin was positively correlated with low-density lipoprotein cholesterol levels and markers of systemic inflammation. CSF resistin concentrations were generally low.
26505548 Resistin was not associated with radiographic knee osteoarthritis severity or knee cartilage volume in knee osteoarthritis.
26466550 significant association between resistin, both PBMCs mRNA and plasma protein, and the relative proportion of sdLDL particles in the circulation of coronary artery disease patients
26448186 Significantly higher plasma resistin levels are observed among healthy khat addicted subjects as compared to non addicted healthy controls.
26404063 RETN promoter SNPs might influence the circulating resistin level through an effect on DNA methylation and on RETN mRNA abundance in monocytes
26385595 Resistin diminishes ATP content through the targeting of ATP5S mRNA 3'UTR by miR-34a.
26365964 Data show interaction of Polymorphisms of Resistin Gene Promoter -420C/G, Glutathione Peroxidase -1 Gene Pro198Leu and Cigarette Smoking in Nonalcoholic Fatty Liver Disease
More...

AA Sequence

MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVT      1 - 70
GCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP                                     71 - 108
//

Text Mined References (447)

PMID Year Title
27214983 2015 [INSULIN-LIKE GROWTH FACTOR-1: THE INFLUENCE ON THE LIVER FUNCTION AND RELATIONSHIPS WITH RESISTIN IN PATIENTS WITH NONALCOHOLIC FATTY LIVER DISEASE AND ITS COMBINATION WITH TYPE 2 DIABETES MELLITUS].
26967765 Evaluation of insulin resistance and plasma levels for visfatin and resistin in obese and non-obese patients with polycystic ovary syndrome.
26690142 2015 Fulvic Acid Attenuates Resistin-Induced Adhesion of HCT-116 Colorectal Cancer Cells to Endothelial Cells.
26509463 2016 Quantification and regulation of the adipokines resistin and progranulin in human cerebrospinal fluid.
26505548 2016 Association between circulating adipokines, radiographic changes, and knee cartilage volume in patients with knee osteoarthritis.
26466550 2016 Higher circulating resistin protein and PBMCs resistin mRNA levels are associated with increased prevalence of small dense LDL particles in coronary artery disease patients.
26448186 2015 Correlation between Resistin, Tuberculosis and Khat Addiction: A Study from South Western Province of Saudi Arabia.
26404063 2015 Epigenome-wide association study suggests that SNPs in the promoter region of RETN influence plasma resistin level via effects on DNA methylation at neighbouring sites.
26385595 2015 MiR-34a is Involved in the Decrease of ATP Contents Induced by Resistin Through Target on ATP5S in HepG2 Cells.
26365964 2015 Interaction of Polymorphisms of Resistin Gene Promoter -420C/G, Glutathione Peroxidase -1 Gene Pro198Leu and Cigarette Smoking in Nonalcoholic Fatty Liver Disease.
More...