Property Summary

NCBI Gene PubMed Count 41
Grant Count 16
R01 Count 3
Funding $3,003,308.34
PubMed Score 32.88
PubTator Score 53.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (22)

PMID Text
26573744 MYO10 (myosin X), a direct miR340 target gene, mediated the migration and invasion of breast cancer cells
26235048 Myo10 plays a key role in integrating the actin and microtubule cytoskeletons to position centrosomes and mitotic spindles.
25819274 New research implicates Myo10 in a number of disease states including cancer metastasis and pathogen infection.
25749519 Results suggest that NF-kappaB-regulated miR-124 targets MYO10, inhibits cell invasion and metastasis, and is down-regulated in node-positive NSCLC.
25605337 PCTK1 regulates spindle orientation through phosphorylation of Ser83 on KAP0, a regulatory subunit of protein kinase A.
24921915 Elevated MYO10 expression and involvement in invadopodia formation increases the aggressiveness of breast cancer .
24487586 Myo10 upregulation in mutant p53-driven cancers is necessary for invasion and that plasma-membrane protrusions.
24379415 Phosphorylation of ADD1 at Ser12 and Ser355 by cyclin-dependent kinase 1 enables ADD1 to bind to myosin-X (Myo10).
23943878 Study demonstrates a novel biological function for Hdl-Myo10 and an important new role for both Myo10 isoforms in the development of dendritic spines and synapses.
23083060 Authors conclude thatMyo10 generates the force to enhance bacterial-induced cell membrane protrusions by binding its head region to actin filaments and its PH tail domain to the peripheral membrane.
More...

AA Sequence

MDNFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPTNEEGVDDMAS      1 - 70
LTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQYSRRHLGELPPHIFAIANEC     71 - 140
YRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQSLELSLKEKTSCVERAILESSPIMEAFGNA    141 - 210
KTVYNNNSSRFGKFVQLNICQKGNIQGGRIVDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYL    211 - 280
STPENYHYLNQSGCVEDKTISDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVS    281 - 350
FKTALGRSAELLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSR    351 - 420
IKGNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWIDNG    421 - 490
ECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVAVNNFGVKHYAGEVQYDVRGI    491 - 560
LEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTLKCGSKHRRPTVSSQFKDSLHSLMATLSSSN    561 - 630
PFFVRCIKPNMQKMPDQFDQAVVLNQLRYSGMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPEDVR    631 - 700
GKCTSLLQLYDASNSEWQLGKTKVFLRESLEQKLEKRREEEVSHAAMVIRAHVLGFLARKQYRKVLYCVV    701 - 770
IIQKNYRAFLLRRRFLHLKKAAIVFQKQLRGQIARRVYRQLLAEKREQEEKKKQEEEEKKKREEEERERE    771 - 840
RERREAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELS    841 - 910
LTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKP    911 - 980
NFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSADST    981 - 1050
VLLAPSVQDSGSLHNSSSGESTYCMPQNAGDLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPD   1051 - 1120
YRCSVGTYNSSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMN   1121 - 1190
SWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGT   1191 - 1260
VEVRTAKEIIDNTTKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIQEMHDEQANPQNAV   1261 - 1330
GTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLH   1331 - 1400
KEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYG   1401 - 1470
RKHCYRLYTKLLNEATRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPL   1471 - 1540
HSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQL   1541 - 1610
IKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTK   1611 - 1680
CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGH   1681 - 1750
VDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHH   1751 - 1820
PAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLR   1821 - 1890
RSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDV   1891 - 1960
ECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVA   1961 - 2030
KLMKAYISMIVKKRYSTTRSASSQGSSR                                             2031 - 2058
//

Text Mined References (46)

PMID Year Title
26573744 2016 MiR-340 suppresses cell migration and invasion by targeting MYO10 in breast cancer.
26235048 2015 Direct Microtubule-Binding by Myosin-10 Orients Centrosomes toward Retraction Fibers and Subcortical Actin Clouds.
25819274 2015 Myosin-X and disease.
25749519 2015 NF-?B-mediated miR-124 suppresses metastasis of non-small-cell lung cancer by targeting MYO10.
25605337 2015 PCTK1 regulates integrin-dependent spindle orientation via protein kinase A regulatory subunit KAP0 and myosin X.
25416956 2014 A proteome-scale map of the human interactome network.
24921915 2014 Elevated expression of myosin X in tumours contributes to breast cancer aggressiveness and metastasis.
24487586 2014 Mutant p53-associated myosin-X upregulation promotes breast cancer invasion and metastasis.
24379415 2014 Adducin-1 is essential for mitotic spindle assembly through its interaction with myosin-X.
23943878 2013 Myosin X and its motorless isoform differentially modulate dendritic spine development by regulating trafficking and retention of vasodilator-stimulated phosphoprotein.
More...