Property Summary

NCBI Gene PubMed Count 29
PubMed Score 24.10
PubTator Score 39.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count
Adenoid Cystic Carcinoma 99

Gene RIF (8)

PMID Text
26937656 Strong immune responses to the cancer testis antigen XAGE-1b have been found in non-small cell lung cancer Caucasian patients.
24304136 Data indicate the involvement of immunoglobulin allotypes immunoglobulin gamma and kappa chains in immunity to a cancer-testis antigen, which has important implications for XAGE-1b-based immunotherapeutic interventions in lung adenocarcinoma.
24008415 XAGE-1b gene was able to influence angiogenesis directly or indirectly, leading to tumorigenesis and metastasis of ACC.
23625514 Our results suggest that GAGE, XAGE1 and SSX4 might each have a role in melanoma progression
20178013 the XAGE-1b gene was expressed at the mRNA level in a proportion of human acute leukemia
18752338 The findings suggest that XAGE-1b and HLA class I expression elicited a CD8+ T-cell response against minimal residual disease after surgery and resulted in prolonged survival of non-small cell lung cancer patients.
17704638 A 12-mer peptide XAGE-1b(37-48) as a new XAGE-1b epitope restricted to HLA-DRB1*0410 was identified.
17332921 Recognition of XAGE-1b on OU-LU-6 tumor by the CD4-expressing tumor-infiltrating lymphocytes was studied.

AA Sequence

MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCK      1 - 70
MPEAGEEQPQV                                                                71 - 81
//

Text Mined References (32)

PMID Year Title
26937656 2016 Immune Responses to the Cancer Testis Antigen XAGE-1b in Non Small Cell Lung Cancer Caucasian Patients.
25416956 2014 A proteome-scale map of the human interactome network.
24304136 2014 Genetic variants of immunoglobulin ? and ? chains influence humoral immunity to the cancer-testis antigen XAGE-1b (GAGED2a) in patients with non-small cell lung cancer.
24008415 2013 Promoting effects on the proliferation and metastasis of ACC tumor cell with XAGE-1b overexpression.
23625514 2013 Effects of CT-Xp gene knock down in melanoma cell lines.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21413013 2012 Heteroclitic serological response in esophageal and prostate cancer patients after NY-ESO-1 protein vaccination.
21305256 2011 NLS-dependent and insufficient nuclear localization of XAGE-1 splice variants.
20704819 2010 [Association of XAGE-1 gene expression with clinical characteristics of lung cancer].
20178013 2010 mRNA expression of the XAGE-1 gene in human acute leukemia.
More...