Property Summary

NCBI Gene PubMed Count 30
PubMed Score 0.00
PubTator Score 39.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Disease Target Count
Adenoid Cystic Carcinoma 99

Gene RIF (9)

AA Sequence

MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCK      1 - 70
MPEAGEEQPQV                                                                71 - 81
//

Text Mined References (34)

PMID Year Title