Property Summary

NCBI Gene PubMed Count 15
PubMed Score 22.71
PubTator Score 11.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.600 2.0e-06
ovarian cancer -1.400 1.5e-07

Gene RIF (5)

AA Sequence

MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYHFED      1 - 70
VGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIAKENQQVAKDVTLHQALLRLPQYQTDLLL     71 - 140
TFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDPNIFGPQ                            141 - 186
//

Text Mined References (18)

PMID Year Title