Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
R01 Count 1
Funding $99,062
PubMed Score 18.40
PubTator Score 11.15

Knowledge Summary

Patent

No data available

Synonym

Accession Q9HD47 D3DTR6 Q68DI3 Q9BR68 Q9HD48 Q9NRU9 Q9P001 Q9P0P2 RanGNRF
Symbols MOG1
HSPC165
HSPC236
RANGNRF

Gene

 Grant Application (1)

Gene RIF (5)

PMID Text
24438356 Compound mutation of CACNA2D1 and RANGRF genes were found. To the best of our knowledge, this is the first comprehensive description of the concurrence of these two mutations and histiocytoid cardiomyopathy.
24142675 Suggest that p.E61X_RANGRF is a rare genetic variation with an uncertain role in Brugada Syndrome.
21621375 Our screening of Nav1.5 cofactor MOG1 uncovered a novel nonsense variant that appeared to be present at a higher frequency among these patients with atrial fibrillation and Brugada syndrome than control subjects.
21447824 Results suggest that dominant-negative mutations in MOG1 can impair the trafficking of Na(v)1.5 to the membrane, leading to I(Na) reduction and clinical manifestation of Brugada syndrome.
18184654 in cardiomyocytes, MOG1 is mostly localized in the cell membrane and co-localized with Nav1.5, indicating that MOG1 is a critical regulator of sodium channel function in the heart

AA Sequence

MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYHFED      1 - 70
VGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIAKENQQVAKDVTLHQALLRLPQYQTDLLL     71 - 140
TFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDPNIFGPQ                            141 - 186
//

Text Mined References (17)

PMID Year Title
24438356 2015 The perfect storm? Histiocytoid cardiomyopathy and compound CACNA2D1 and RANGRF mutation in a baby.
24142675 2014 Brugada syndrome and p.E61X_RANGRF.
23420830 2013 MOG1 rescues defective trafficking of Na(v)1.5 mutations in Brugada syndrome and sick sinus syndrome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21621375 A novel nonsense variant in Nav1.5 cofactor MOG1 eliminates its sodium current increasing effect and may increase the risk of arrhythmias.
21447824 2011 MOG1: a new susceptibility gene for Brugada syndrome.
21269460 2011 Initial characterization of the human central proteome.
18184654 2008 Identification of a new co-factor, MOG1, required for the full function of cardiac sodium channel Nav 1.5.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...