Property Summary

NCBI Gene PubMed Count 7
PubMed Score 41.86
PubTator Score 15.56

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9HD45 Q5TB57 Q6UWE7 Q9NWL8 Q9P0G9 Q9UHW8
Symbols SMBP
EP70-P-iso

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MRPLPGALGVAAAAALWLLLLLLPRTRADEHEHTYQDKEEVVLWMNTVGPYHNRQETYKYFSLPFCVGSK      1 - 70
KSISHYHETLGEALQGVELEFSGLDIKFKDDVMPATYCEIDLDKEKRDAFVYAIKNHYWYQMYIDDLPIW     71 - 140
GIVGEADENGEDYYLWTYKKLEIGFNGNRIVDVNLTSEGKVKLVPNTKIQMSYSVKWKKSDVKFEDRFDK    141 - 210
YLDPSFFQHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGD    211 - 280
VFRPSSHPLIFSSLIGSGCQIFAVSLIVIIVAMIEDLYTERGSMLSTAIFVYAATSPVNGYFGGSLYARQ    281 - 350
GGRRWIKQMFIGAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICFFVILPLNLVGTILGRNL    351 - 420
SGQPNFPCRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVI    421 - 490
LCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFS    491 - 560
TALGIMCGAIGYMGTSAFVRKIYTNVKID                                             561 - 589
//

Text Mined References (13)

PMID Year Title