Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.86
PubTator Score 14.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer -1.100 4.9e-02
esophageal adenocarcinoma 2.000 1.8e-02
intraductal papillary-mucinous carcinoma... 1.600 4.1e-03
intraductal papillary-mucinous neoplasm ... 2.000 4.2e-03
lung adenocarcinoma 1.400 3.1e-05
lung carcinoma 1.500 3.0e-30
malignant mesothelioma -1.700 1.7e-07
pancreatic cancer 1.100 7.0e-04

Gene RIF (3)

AA Sequence

MAGAGGGLGVWGNLVLLGLCSWTGARAPAPNPGRNLTVETQTTSSISLSWEVPDGLDSQNSNYWVQCTGD      1 - 70
GGTTETRNTTATNVTVDGLGPGSLYTCSVWVEKDGVNSSVGTVTTATAPNPVRNLRVEAQTNSSIALTWE     71 - 140
VPDGPDPQNSTYGVEYTGDGGRAGTRSTAHTNITVDGLEPGCLYAFSMWVGKNGINSSRETRNATTAHNP    141 - 210
VRNLRVEAQTTSSISLSWEVPDGTDPQNSTYCVQCTGDGGRTETRNTTDTRVTVDGLGPGSLYTCSVWVE    211 - 280
KDGVNSSVEIVTSATAPNPVRNLTVEAQTNSSIALTWEVPDGPDPQNSTYGVEYTGDGGRAGTRSTAHTN    281 - 350
ITVDRLEPGCLYVFSVWVGKNGINSSRETRNATTAPNPVRNLHMETQTNSSIALCWEVPDGPYPQDYTYW    351 - 420
VEYTGDGGGTETRNTTNTSVTAERLEPGTLYTFSVWAEKNGARGSRQNVSISTVPNAVTSLSKQDWTNST    421 - 490
IALRWTAPQGPGQSSYSYWVSWVREGMTDPRTQSTSGTDITLKELEAGSLYHLTVWAERNEVRGYNSTLT    491 - 560
AATAPNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRTNETWY    561 - 630
KVEALEPGTLYNFTVWAERNDVASSTQSLCASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEV    631 - 700
GGQRGSQDRSSCGEAVSVLGLGPARSYPATITTIWDGMKVVSHSVVCHTESAGVIAGAFVGILLFLILVG    701 - 770
LLIFFLKRRNKKKQQKPELRDLVFSSPGDIPAEDFADHVRKNERDSNCGFADKYQQLSLVGHSQSQMVAS    771 - 840
ASENNAKNRYRNVLPYDWSRVPLKPIHEEPGSDYINASFMPGLWSPQEFIATQGPLPQTVGDFWRLVWEQ    841 - 910
QSHTLVMLTNCMEAGRVKCEHYWPLDSQPCTHGHLRVTLVGEEVMENWTVRELLLLQVEEQKTLSVRQFH    911 - 980
YQAWPDHGVPSSPDTLLAFWRMLRQWLDQTMEGGPPIVHCSAGVGRTGTLIALDVLLRQLQSEGLLGPFS    981 - 1050
FVRKMRESRPLMVQTEAQYVFLHQCILRFLQQSAQAPAEKEVPYEDVENLIYENVAAIQAHKLEV        1051 - 1115
//

Text Mined References (15)

PMID Year Title