Property Summary

NCBI Gene PubMed Count 33
Grant Count 1
Funding $77,992
PubMed Score 14.24
PubTator Score 16.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 0.000
osteosarcoma -1.916 0.000

Synonym

Accession Q9HD42 A2RU09 Q14468 Q15779 Q96G31
Symbols PCH8
CHMP1
PRSM1
PCOLN3
VPS46A
VPS46-1

Gene

PANTHER Protein Class (1)

 Grant Application (1)

PDB

2YMB   4A5X   2JQ9  

Gene RIF (8)

PMID Text
23748770 we identified Ser(179) and Ser(182) located in the C-terminal region of the CHMP1A as major phosphorylation sites that cause a mobility shift.
23273016 Study reports the discovery of a chimeric RNA between ZC3HAV1L and CHMP1A in human, located on chromosome 7 and 16, respectively. The fusion occurs at an exon-exon boundary, and was detected both computationally and experimentally from different cells or tissue types.
23023333 Our results suggest that CHMP1A serves as a critical link between cytoplasmic signals and BMI1-mediated chromatin modifications that regulate proliferation of central nervous system progenitor cells.
22261332 our results demonstrate that Chmp1A functions as a tumor suppressor gene in renal cells
21705858 Chmp1A regulates tumor growth through ATM sugnaling and that neclear locaization of Chmp1A is reqired for the growth inhibition and ATM activation.
19640981 Both Vps4A and CHMP1A localized in the vicinity of viral cytoplasmic assembly compartments, sites of viral maturation that develop in Cytomegalovirus-infected cells. Thus, ESCRT machinery is involved in the final steps of HCMV replication.
18787405 Chmp1A is a novel tumor suppressor, especially in pancreas and that Chmp1A regulates tumor growth potentially through p53 signaling pathway.
17711858 UBPY MIT domain and another ubiquitin isopeptidase, AMSH, reveals common interactions with CHMP1A and CHMP1B but a distinct selectivity of AMSH for CHMP3/VPS24, a core subunit of the ESCRT-III complex, and UBPY for CHMP7.

AA Sequence

MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVD      1 - 70
AVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLT     71 - 140
TPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN                  141 - 196
//

Text Mined References (38)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23748770 2013 Identification of phosphorylation sites in the C-terminal region of charged multivesicular body protein 1A (CHMP1A).
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23273016 2012 Detection of a common chimeric transcript between human chromosomes 7 and 16.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045692 2012 ESCRT-III binding protein MITD1 is involved in cytokinesis and has an unanticipated PLD fold that binds membranes.
23023333 2012 CHMP1A encodes an essential regulator of BMI1-INK4A in cerebellar development.
22261332 2012 Chmp1A acts as a tumor suppressor gene that inhibits proliferation of renal cell carcinoma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...