Property Summary

NCBI Gene PubMed Count 33
PubMed Score 14.92
PubTator Score 16.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.916 9.8e-09
psoriasis -1.400 1.4e-04

Gene RIF (8)

AA Sequence

MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVD      1 - 70
AVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLT     71 - 140
TPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN                  141 - 196
//

Text Mined References (38)

PMID Year Title