Tbio | O-phosphoseryl-tRNA(Sec) selenium transferase |
Converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.
The amino acid selenocysteine is the only amino acid that does not have its own tRNA synthetase. Instead, this amino acid is synthesized on its cognate tRNA in a three step process. The protein encoded by this gene catalyzes the third step in the process, the conversion of O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec).[provided by RefSeq, Mar 2011]
The amino acid selenocysteine is the only amino acid that does not have its own tRNA synthetase. Instead, this amino acid is synthesized on its cognate tRNA in a three step process. The protein encoded by this gene catalyzes the third step in the process, the conversion of O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec).[provided by RefSeq, Mar 2011]
Comments
Disease | Target Count | P-value |
---|---|---|
tuberculosis | 1563 | 1.59650625315474E-7 |
ovarian cancer | 8492 | 1.88216102566047E-7 |
posterior fossa group B ependymoma | 1530 | 3.97675776063499E-6 |
atypical teratoid / rhabdoid tumor | 4369 | 2.75989141175603E-4 |
pediatric high grade glioma | 2712 | 3.12677483894918E-4 |
glioblastoma | 5572 | 4.3843437232236E-4 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 8.28982875255511E-4 |
primitive neuroectodermal tumor | 3031 | 8.65922495011139E-4 |
osteosarcoma | 7933 | 0.00233228878001612 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 0.00258507609617387 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00277954318240984 |
sonic hedgehog group medulloblastoma | 1482 | 0.0127758568832178 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Pontocerebellar hypoplasia | 29 | 0.0 | 5.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Autoimmune hepatitis | 13 | 7.098 | 3.5 |
Liver disease | 219 | 4.862 | 2.4 |
Sclerosing cholangitis | 17 | 4.533 | 2.3 |
Spastic quadriplegia | 10 | 3.446 | 1.7 |
Hepatitis C | 90 | 3.379 | 1.7 |
Disease | Target Count |
---|---|
Pontocerebellar hypoplasia type 2D | 1 |
Disease | Target Count |
---|---|
Pontocerebellar hypoplasia 2D | 1 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -1.286 | 0.002 |
posterior fossa group B ependymoma | 1.400 | 0.000 |
glioblastoma | 1.400 | 0.000 |
atypical teratoid / rhabdoid tumor | 1.400 | 0.000 |
primitive neuroectodermal tumor | 1.100 | 0.001 |
pancreatic ductal adenocarcinoma liver m... | -1.556 | 0.003 |
tuberculosis | -1.600 | 0.000 |
intraductal papillary-mucinous adenoma (... | 1.500 | 0.001 |
intraductal papillary-mucinous neoplasm ... | 1.500 | 0.003 |
pediatric high grade glioma | 1.100 | 0.000 |
sonic hedgehog group medulloblastoma | 1.100 | 0.013 |
ovarian cancer | -1.500 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26115735 | results suggest SEPSECS as a candidate gene for progressive encephalopathies with lactate elevation. |
25190812 | structural analysis of the terminal catalytic complex in selenocysteine synthesis |
23966103 | Data suggest SEPSECS silencing in placental trophoblasts inhibits proliferation, induces apoptosis, and reduces production of progesterone/chorionic gonadotropin (P/hCG); SEPSECS over-expression promotes cell proliferation and secretion of P/hCG. |
23112913 | Three SNPs in SEPSECS and SEPHS1 were found to significantly interact with serum selenium level and Crohn's Disease. |
22190034 | HIV-1 MA is identified to have a physical interaction with Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase (SEPSECS) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses |
20920667 | SepSecS mutations cause autosomal-recessive progressive cerebellocerebral atrophy in Jews of Iraqi and Moroccan ancestry. |
20623998 | The human SepSecS protein is also known as soluble liver antigen/liver pancreas (SLA/LP), which represents one of the antigens of autoimmune hepatitis. |
20471133 | Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) |
19683415 | detectable in liver extracts of autoimmune hepatitis patients' cells as the major autoantigenic component |
19608919 | crystal structure of tRNA(Sec) in complex with SepSecS, phosphoserine, and thiophosphate, together with in vivo and in vitro enzyme assays, supports a pyridoxal phosphate-dependent mechanism of Sec-tRNA(Sec) formation |
MNRESFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEKGKCPENGWDESTLELFLHELAIMDSNNFLGNC 1 - 70 GVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANCFVV 71 - 140 PMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQ 141 - 210 ELGPDCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQSSKCMHLIQQGARVGRIDAFVQ 211 - 280 SLDKNFMVPVGGAIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSN 281 - 350 QIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRDKAVTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFR 351 - 420 GFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDNYDKTEDVDIEEMALKLDN 421 - 490 VLLDTYQDASS 491 - 501 //
PMID | Year | Title |
---|---|---|
26115735 | 2015 | Selenoprotein biosynthesis defect causes progressive encephalopathy with elevated lactate. |
25190812 | 2014 | Structural asymmetry of the terminal catalytic complex in selenocysteine synthesis. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
23966103 | 2013 | The role of Sep (O-phosphoserine) tRNA: Sec (selenocysteine) synthase (SEPSECS) in proliferation, apoptosis and hormone secretion of trophoblast cells. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
23112913 | 2012 | Selenium, selenoprotein genes and Crohn's disease in a case-control population from Auckland, New Zealand. |
22190034 | 2011 | Global landscape of HIV-human protein complexes. |
20920667 | 2010 | Mutations disrupting selenocysteine formation cause progressive cerebello-cerebral atrophy. |
20623998 | 2010 | Human SepSecS or SLA/LP: selenocysteine formation and autoimmune hepatitis. |
20471133 | 2011 | A combination of functional polymorphisms in the CASP8, MMP1, IL10 and SEPS1 genes affects risk of non-small cell lung cancer. |
More... |