Property Summary

NCBI Gene PubMed Count 22
PubMed Score 120.51
PubTator Score 83.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
PONTOCEREBELLAR HYPOPLASIA, TYPE 2D 1 0.0 0.0
Weight Gain 100 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Pontocerebellar hypoplasia 36 3.656 1.8
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Neurodegenerative disease 414 0.0 4.0
Disease Target Count
Pontocerebellar hypoplasia type 2D 1

Expression

Gene RIF (12)

AA Sequence

MNRESFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEKGKCPENGWDESTLELFLHELAIMDSNNFLGNC      1 - 70
GVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANCFVV     71 - 140
PMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQ    141 - 210
ELGPDCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQSSKCMHLIQQGARVGRIDAFVQ    211 - 280
SLDKNFMVPVGGAIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSN    281 - 350
QIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRDKAVTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFR    351 - 420
GFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDNYDKTEDVDIEEMALKLDN    421 - 490
VLLDTYQDASS                                                               491 - 501
//

Text Mined References (29)

PMID Year Title