Property Summary

NCBI Gene PubMed Count 20
Grant Count 8
R01 Count 5
Funding $592,661.33
PubMed Score 114.22
PubTator Score 83.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26115735 results suggest SEPSECS as a candidate gene for progressive encephalopathies with lactate elevation.
25190812 structural analysis of the terminal catalytic complex in selenocysteine synthesis
23966103 Data suggest SEPSECS silencing in placental trophoblasts inhibits proliferation, induces apoptosis, and reduces production of progesterone/chorionic gonadotropin (P/hCG); SEPSECS over-expression promotes cell proliferation and secretion of P/hCG.
23112913 Three SNPs in SEPSECS and SEPHS1 were found to significantly interact with serum selenium level and Crohn's Disease.
22190034 HIV-1 MA is identified to have a physical interaction with Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase (SEPSECS) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 MA is identified to have a physical interaction with Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase (SEPSECS) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20920667 SepSecS mutations cause autosomal-recessive progressive cerebellocerebral atrophy in Jews of Iraqi and Moroccan ancestry.
20623998 The human SepSecS protein is also known as soluble liver antigen/liver pancreas (SLA/LP), which represents one of the antigens of autoimmune hepatitis.
20471133 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19683415 detectable in liver extracts of autoimmune hepatitis patients' cells as the major autoantigenic component
More...

AA Sequence

MNRESFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEKGKCPENGWDESTLELFLHELAIMDSNNFLGNC      1 - 70
GVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANCFVV     71 - 140
PMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQ    141 - 210
ELGPDCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQSSKCMHLIQQGARVGRIDAFVQ    211 - 280
SLDKNFMVPVGGAIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSN    281 - 350
QIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRDKAVTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFR    351 - 420
GFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDNYDKTEDVDIEEMALKLDN    421 - 490
VLLDTYQDASS                                                               491 - 501
//

Text Mined References (27)

PMID Year Title
26115735 2015 Selenoprotein biosynthesis defect causes progressive encephalopathy with elevated lactate.
25190812 2014 Structural asymmetry of the terminal catalytic complex in selenocysteine synthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23966103 2013 The role of Sep (O-phosphoserine) tRNA: Sec (selenocysteine) synthase (SEPSECS) in proliferation, apoptosis and hormone secretion of trophoblast cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23112913 2012 Selenium, selenoprotein genes and Crohn's disease in a case-control population from Auckland, New Zealand.
22190034 2011 Global landscape of HIV-human protein complexes.
20920667 2010 Mutations disrupting selenocysteine formation cause progressive cerebello-cerebral atrophy.
20623998 2010 Human SepSecS or SLA/LP: selenocysteine formation and autoimmune hepatitis.
20471133 2011 A combination of functional polymorphisms in the CASP8, MMP1, IL10 and SEPS1 genes affects risk of non-small cell lung cancer.
More...