Property Summary

NCBI Gene PubMed Count 35
Grant Count 128
R01 Count 31
Funding $25,662,763.45
PubMed Score 531.98
PubTator Score 47.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9HD36 Q3SX80 Q52LQ9 Q8TCS9 Bcl2-L-10
Symbols Boo
Diva
BCL-B
bcl2-L-10

Gene

PANTHER Protein Class (1)

PDB

4B4S  

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
951 screening 142 / 440 / 194237 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B.
1327 confirmatory 6 / 0 / 828 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B protein.
1693 summary 1 / 0 / 0 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions via Bim (BCL2-like 11)
2077 confirmatory 9 / 0 / 33 Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B
504598 other 3 / 0 / 19 Dose response of powder sourced compounds for small molecule regulators of Bcl-2 family protein interactions, panel upload with wildtype and mutant Bfl1 and wildtype BclB.
504627 other 0 / 0 / 0 Bcl-2 family members Fluorescence polarization assay with Set1 of powder compounds
588716 confirmatory 3 / 0 / 0 Isothermal titration calorimetry (ITC) with Bcl-B and compounds active in primary screen

Gene RIF (24)

PMID Text
24047476 Identification of a variant in the BCL2L10 gene as a protective factor for the development of therapy-related myeloid neoplasms and de novo myelodysplastic syndrome.
23563182 polyubiquitination and proteasomal turnover dictate the expression level and anti-apoptotic capacity of Bcl-B
23293224 Data suggest that BCL2L10 is localized predominantly to mitochondria in high-quality preimplantation embryos/blastocysts; in contrast, abnormal embryos/blastocysts exhibit extra-mitochondrial localization (cytoplasm/cell nucleus) of BCL2L10.
23235460 Bcl-B in complex with the BH3 motif of Bim protected cells from Bax-dependent apoptotic pathways.
22577154 expression is predictive of azacitidine-resistance in myelodysplastic syndrome patients
22498477 Bcl-B interacts with the BH3 domain of BECN1 and Bcl-B overexpression reduces autophagy triggered by a variety of pro-autophagic stimuli.
22233804 Ubqln stabilizes BCLb protein, while also promoting monoubiquitination on multiple lysine residues and relocation to the cytosol.
21760590 BCL2L10 methylation is associated with myelodysplastic syndromes.
21171085 The pro-apoptotic effect of BCL2L10 and growth promotion by BCL2L10 siRNA in gastric cancer cells suggest that it may be a tumour suppressor.
21166696 Loss of BCL2L10 protein expression predicts poor clinical outcome in gastric carcinoma.
More...

AA Sequence

MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVAL      1 - 70
MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLM     71 - 140
GQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL                    141 - 194
//

Text Mined References (37)

PMID Year Title
24047476 2014 The BCL2L10 Leu21Arg variant and risk of therapy-related myeloid neoplasms and de novo myelodysplastic syndromes.
23563182 2013 Polyubiquitination and proteasomal turnover controls the anti-apoptotic activity of Bcl-B.
23293224 2013 Subcellular dynamics of the maternal cell death regulator BCL2L10 in human preimplantation embryos.
23235460 2012 The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist.
22577154 2012 BCL2L10 is a predictive factor for resistance to azacitidine in MDS and AML patients.
22498477 2012 The anti-apoptotic Bcl-B protein inhibits BECN1-dependent autophagic cell death.
22233804 2012 Ubiquitination, localization, and stability of an anti-apoptotic BCL2-like protein, BCL2L10/BCLb, are regulated by Ubiquilin1.
21760590 2011 Role of BCL2L10 methylation and TET2 mutations in higher risk myelodysplastic syndromes treated with 5-azacytidine.
21171085 2011 BCL2L10 protein regulates apoptosis/proliferation through differential pathways in gastric cancer cells.
21166696 2010 Loss of BCL2L10 protein expression as prognostic predictor for poor clinical outcome in gastric carcinoma.
More...