Property Summary

Ligand Count 1
NCBI Gene PubMed Count 39
PubMed Score 562.20
PubTator Score 47.09

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

AA Sequence

MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVAL      1 - 70
MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLM     71 - 140
GQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL                    141 - 194
//

Text Mined References (41)

PMID Year Title