Property Summary

NCBI Gene PubMed Count 26
Grant Count 17
R01 Count 14
Funding $909,777.93
PubMed Score 14.68
PubTator Score 12.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.744 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.002
lung cancer 2.600 0.001
group 3 medulloblastoma 1.200 0.003
inflammatory breast cancer -1.300 0.000
ovarian cancer 1.400 0.001

Gene RIF (15)

PMID Text
26342079 Our findings highlight that the ISD11 R68A/R68L mutation display reduced affinity to form a stable subcomplex with NFS1, and thereby fails to prevent NFS1 aggregation resulting in impairment of the Fe-S cluster biogenesis
23814038 Homozygous mutation in LYRM4 was reported in two patients with combined oxidative phosphorylation deficiency.
22277967 Strong candidate gene for mitochondrial disease, based on recessive mutations detected in infantile patients
21968932 LYRM4 downregulation may be one of the mechanisms involved in inefficient oxidative phosphorylation and oxidative stress, increasingly recognised as contributors to schizophrenia pathogenesis.
21072187 Observational study of gene-disease association. (HuGE Navigator)
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQV      1 - 70
HIGQLYSTDKLIIENRDMPRT                                                      71 - 91
//

Text Mined References (29)

PMID Year Title
26342079 2015 Mapping Key Residues of ISD11 Critical for NFS1-ISD11 Subcomplex Stability: IMPLICATIONS IN THE DEVELOPMENT OF MITOCHONDRIAL DISORDER, COXPD19.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23814038 2013 Mutations in LYRM4, encoding iron-sulfur cluster biogenesis factor ISD11, cause deficiency of multiple respiratory chain complexes.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
22277967 2012 Molecular diagnosis of infantile mitochondrial disease with targeted next-generation sequencing.
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21968932 2012 Promoter polymorphisms in two overlapping 6p25 genes implicate mitochondrial proteins in cognitive deficit in schizophrenia.
21269460 2011 Initial characterization of the human central proteome.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
More...