Property Summary

NCBI Gene PubMed Count 29
PubMed Score 16.59
PubTator Score 12.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 19 1 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 2.1
Disease Target Count Z-score Confidence
Friedreich ataxia 24 5.705 2.9

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.200 3.3e-03
inflammatory breast cancer -1.300 5.6e-06
intraductal papillary-mucinous neoplasm ... -1.300 1.8e-03
lung cancer 2.600 5.2e-04
osteosarcoma -1.744 1.1e-04
ovarian cancer 1.400 5.6e-04

Gene RIF (18)

AA Sequence

MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQV      1 - 70
HIGQLYSTDKLIIENRDMPRT                                                      71 - 91
//

Text Mined References (32)

PMID Year Title