Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.08
PubTator Score 2.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 1.0e-15
Breast cancer 3578 1.6e-09
ovarian cancer 8520 8.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Leber hereditary optic neuropathy 14 3.075 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.100 1.6e-09
non-small cell lung cancer 1.171 1.0e-15
ovarian cancer 2.200 8.1e-05

 MGI Phenotype (1)

Gene RIF (1)

AA Sequence

MAAAGLALLCRRVSSALKSSRSLITPQVPACTGFFLSLLPKSTPNVTSFHQYRLLHTTLSRKGLEEFFDD      1 - 70
PKNWGQEKVKSGAAWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLDKVVDSMD     71 - 140
ALDKVVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRYNRKRFFALPYVDHFLR    141 - 210
LEREKRARIKARKENLERKKAKILLKKFPHLAEAQKSSLV                                  211 - 250
//

Text Mined References (13)

PMID Year Title