Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.01
PubTator Score 2.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer 1.171 0.000
ovarian cancer 2.200 0.000
Breast cancer 2.100 0.000

Synonym

Accession Q9HD33 Q6XRG1 Q8N5D1 L47mt
Symbols NCM1
L47mt
CGI-204
MRP-L47

Gene

PDB

3J9M   3J7Y  

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAAGLALLCRRVSSALKSSRSLITPQVPACTGFFLSLLPKSTPNVTSFHQYRLLHTTLSRKGLEEFFDD      1 - 70
PKNWGQEKVKSGAAWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLDKVVDSMD     71 - 140
ALDKVVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRYNRKRFFALPYVDHFLR    141 - 210
LEREKRARIKARKENLERKKAKILLKKFPHLAEAQKSSLV                                  211 - 250
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943462 2002 Evolution of a protein-rich mitochondrial ribosome: implications for human genetic disease.
More...