Property Summary

NCBI Gene PubMed Count 52
PubMed Score 54.13
PubTator Score 49.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
lung cancer 4740 0.0 3.0
Disease Target Count Z-score Confidence
cystic fibrosis 1695 4.157 2.1

Expression

  Differential Expression (9)

Disease log2 FC p
Alzheimer's disease -1.100 2.9e-02
atypical teratoid / rhabdoid tumor 1.300 2.3e-05
glioblastoma 1.300 4.2e-05
group 4 medulloblastoma 1.100 7.0e-04
medulloblastoma, large-cell 1.100 6.2e-03
osteosarcoma 2.405 2.3e-06
ovarian cancer -1.500 1.2e-06
Pick disease -1.500 2.1e-06
progressive supranuclear palsy -1.100 1.8e-02

 GO Function (1)

Gene RIF (21)

AA Sequence

MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKM      1 - 70
TSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQS     71 - 140
ADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYL    141 - 210
DKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKS    211 - 280
QGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHK    281 - 350
EAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG    351 - 420
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY                                421 - 462
//

Text Mined References (55)

PMID Year Title