Property Summary

NCBI Gene PubMed Count 51
Grant Count 111
R01 Count 62
Funding $14,927,165.59
PubMed Score 48.45
PubTator Score 49.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.405 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.300 0.000
medulloblastoma 1.400 0.002
medulloblastoma, large-cell 1.800 0.002
Alzheimer's disease -1.100 0.029
Pick disease -1.500 0.000
progressive supranuclear palsy -1.100 0.018
ovarian cancer 1.900 0.000

Synonym

Accession Q9HD26 A6NM30 Q59FS4 Q969U8
Symbols CAL
FIG
PIST
GOPC1
dJ94G16.2

Gene

PDB

2DC2   2LOB   4E34   4E35   4JOE   4JOF   4JOG   4JOH   4JOJ   4JOK   4JOP   4JOR   4K6Y   4K72   4K75   4K76   4K78   4NMO   4NMP   4NMQ   4NMR   4NMS   4NMT   4NMV   4Q6H   4Q6S  

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
504414 screening 54 / 0 / 326957 Fluorescence Polarization with Cer CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-01_Inhibitor_SinglePoint_HTS_Activity
504435 summary 0 / 0 / 0 Broad Institute Small-molecule targeting of CFTR: PDZ Trafficking Interactions Inhibitor Probe Project
504773 confirmatory 29 / 0 / 424 Fluorescence Polarization with Cer CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-01_Inhibitor_Dose_CherryPick_Activity
602252 screening 2737 / 31 / 293918 Fluorescence Polarization with CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-02_Inhibitor_SinglePoint_HTS_Activity
602253 confirmatory 2 / 0 / 6 Fluorescence Polarization with Cer CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-01_Inhibitor_Dose_DryPowder_Activity
602254 confirmatory 9 / 0 / 1028 Fluorescence Polarization with CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-02_Inhibitor_Dose_CherryPick_Activity_Set2
602255 confirmatory 4 / 0 / 4 Fluorescence Polarization with CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-02_Inhibitor_Dose_DryPowder_Activity
602267 confirmatory 13 / 0 / 440 Fluorescence Polarization with CAL-PDZ Measured in Biochemical System Using Plate Reader - 2109-02_Inhibitor_Dose_CherryPick_Activity

Gene RIF (20)

PMID Text
26115868 CAL can regulate the anterograde trafficking, the internalization as well as the signaling of CRFR1 via modulating the post-translational modifications that the receptor undergoes at the Golgi apparatus.
25876703 CAL overexpression retards B2AR expression in Golgi apparatus and reduces the receptor expression in the plasma membrane.
25614626 Our data suggest that PIST contributes to the fine-tuning of b1AR sorting both during biosynthetic and postendocytic trafficking
25231053 Six out of 65 (9%) BTC patients were positive for the FIG-ROS1 fusion, comprising two out of 14 (14%) gallbladder carcinoma (GBC) patients and four out of 25 (16%) extrahepatic cholangiocarcinoma (ECC) patients.
24999209 None of 268 gliomas analysed showed the FIG-ROS1(L) rearrangement.
24210758 Stereochemical preferences modulate affinity and selectivity among CAL PDZ domain protein variants that bind CFTR.
24154728 FIG-ROS fusion protein, which is found in a subset of intrahepatic cholangiocarcinoma patients, accelerates cholangiocarcinogenesis.
23818989 Data indicate that E3 ubiquitin ligase MARCH2 co-immunoprecipitated and co-localized with CAL and syntaxin 6 (STX6), and show the ubiquitination of CFTR by MARCH2.
23545662 The coiled-coil domain of PIST was then purified to homogeneity and crystallized at 293 K. Finally, X-ray diffraction data were collected to a resolution of 4.0 A from a crystal belonging to the hexagonal space group P6(2)22 or P6(4)22.
21543871 crystals of CAL PDZ domain diffracted to 1.4 A resolution
More...

AA Sequence

MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKM      1 - 70
TSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQS     71 - 140
ADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYL    141 - 210
DKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKS    211 - 280
QGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHK    281 - 350
EAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG    351 - 420
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY                                421 - 462
//

Text Mined References (54)

PMID Year Title
26179146 2015 FAM170B, a novel acrosomal protein involved in fertilization in mice.
26115868 2015 Role of cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) in regulating the trafficking and signaling of corticotropin-releasing factor receptor 1.
25876703 2015 Regulation of ?2-adrenergic receptor cell surface expression by interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL).
25614626 2015 The golgi-associated PDZ domain protein PIST/GOPC stabilizes the ?1-adrenergic receptor in intracellular compartments after internalization.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25231053 2014 Screening for the FIG-ROS1 fusion in biliary tract carcinomas by nested PCR.
24999209 2014 Lack of GOPC-ROS1 (FIG-ROS1) rearrangement in adult human gliomas.
24210758 2014 Stereochemical preferences modulate affinity and selectivity among five PDZ domains that bind CFTR: comparative structural and sequence analyses.
24154728 2013 Mouse model of intrahepatic cholangiocarcinoma validates FIG-ROS as a potent fusion oncogene and therapeutic target.
More...