Property Summary

NCBI Gene PubMed Count 15
PubMed Score 327.43
PubTator Score 24.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.100 2.9e-04
lung adenocarcinoma 1.165 3.2e-04
lung cancer 1.200 5.5e-03
malignant mesothelioma 1.300 1.2e-06
non primary Sjogren syndrome sicca -1.100 2.8e-02
ovarian cancer -1.100 7.1e-05

Gene RIF (6)

AA Sequence

MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFR      1 - 70
TSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQELGLQARDLRFQHVMSITVRNNRIIMRMEYL     71 - 140
KAVITPECLLILDYRNLNLEQWLFRELPSQLSGEGQLVTYPLPFEFRAIEALLQYWINTLQGKLSILQPL    141 - 210
ILETLDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFE    211 - 280
KSSAGIDHAEEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSLS    281 - 350
LFGLMGVAFGMNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMASLPKKTLLADR    351 - 420
SMELKNSLRLDGLGSGRSILTNR                                                   421 - 443
//

Text Mined References (16)

PMID Year Title