Property Summary

NCBI Gene PubMed Count 15
Grant Count 32
R01 Count 28
Funding $5,287,380.67
PubMed Score 314.63
PubTator Score 24.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
glioblastoma -1.100 0.000
lung cancer 1.600 0.000
non primary Sjogren syndrome sicca -1.100 0.028
lung adenocarcinoma 1.165 0.000
ovarian cancer 2.200 0.000

Gene RIF (6)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with magnesium homeostasis factor homolog (MRS2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
19270501 Multidrug resistance phenotypes is related to MRS2 mitochondrial magnesium channel.
19242098 By enhanced hsaMrs2p expression, p27 was downregulated whereas cyclinD1 was upregulatedin gastric cancer.
18976975 Knockdown of MRS2 magnesium homeostasis factor homolog by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18384665 hMrs2 is the major transport protein for Mg (+) uptake into mitochondria and that expression of hMrs2 is essential for the maintenance of respiratory complex I and cell viability.

AA Sequence

MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFR      1 - 70
TSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQELGLQARDLRFQHVMSITVRNNRIIMRMEYL     71 - 140
KAVITPECLLILDYRNLNLEQWLFRELPSQLSGEGQLVTYPLPFEFRAIEALLQYWINTLQGKLSILQPL    141 - 210
ILETLDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFE    211 - 280
KSSAGIDHAEEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSLS    281 - 350
LFGLMGVAFGMNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMASLPKKTLLADR    351 - 420
SMELKNSLRLDGLGSGRSILTNR                                                   421 - 443
//

Text Mined References (16)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19270501 2009 Multidrug resistance phenotypes and MRS2 mitochondrial magnesium channel: two players from one stemness?
19242098 2009 Human mitochondrial Mrs2 protein promotes multidrug resistance in gastric cancer cells by regulating p27, cyclin D1 expression and cytochrome C release.
18384665 2009 Conditional knockdown of hMRS2 results in loss of mitochondrial Mg(2+) uptake and cell death.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...