Property Summary

NCBI Gene PubMed Count 65
PubMed Score 595.40
PubTator Score 256.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (43)

AA Sequence

MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSP      1 - 70
GPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRR     71 - 140
LALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFS    141 - 210
EEAANEEKSAATAEKNHTIPGFQQAS                                                211 - 236
//

Text Mined References (69)

PMID Year Title