Property Summary

NCBI Gene PubMed Count 59
Grant Count 18
R01 Count 7
Funding $1,134,623.93
PubMed Score 588.47
PubTator Score 256.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (38)

PMID Text
26581859 Data suggest that expression of SRA1 (mRNA and protein) is linked to cancer cell motility (invasiveness of breast/cervical tumor cells) and regulation of gene expression.
26496121 in human pluripotent stem cells SRA interacts with NANOG and is important for maintenance of the pluripotent state.
25609053 lncRNA SRA expression is potentially associated with PCOS and it has positive correlation with obesity in PCOS, thereby suggesting that elevated lncRNA SRA might be an important mediator in adiposity-related processes in PCOS for susceptible individuals.
24486611 NMR spectra of SRA1p in the presence of its 80-nt RNA target indicate that this protein must be part of a multi-protein complex in order to recognize its proposed RNA recognition element.
24486609 The structure is a five-helix bundle that is distinct from known RNA-binding motifs and instead is similar to the carboxy-terminal domain of the yeast spliceosome protein PRP18, which stabilizes specific protein-protein interactions.
23907597 The presence of SRAP and multiple SRAP-like peptides in estrogen receptor positive breast cancer samples correlates with clinical outcome.
23749764 In endometrioma patients, the surrounding ovarian tissue steroid receptor RNA activator expression is higher compared to controls.
23579816 This study provides evidence that both ER-beta1 and SRAP could be predictive biomarkers of tamoxifen benefit in ER-alpha-negative premenopausal early breast cancer.
22998747 results show that the NTD of ERalpha and AR contains a novel RBM that directly binds SRA, and that STR5 can serve as a novel class of RNA inhibitor of ERalpha and AR signaling by interfering with Pus1p-mediated SRA pseudouridylation
22362738 A report of the first experimentally derived secondary structure of a human lncRNA, the steroid receptor RNA activator.
More...

AA Sequence

MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSP      1 - 70
GPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRR     71 - 140
LALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFS    141 - 210
EEAANEEKSAATAEKNHTIPGFQQAS                                                211 - 236
//

Text Mined References (64)

PMID Year Title
26581859 2015 The steroid receptor RNA activator protein (SRAP) controls cancer cell migration/motility.
26496121 2015 Association of the Long Non-coding RNA Steroid Receptor RNA Activator (SRA) with TrxG and PRC2 Complexes.
25609053 2015 Peripheral blood leukocyte expression level of lncRNA steroid receptor RNA activator (SRA) and its association with polycystic ovary syndrome: a case control study.
24486611 2014 The C-terminal domain of SRA1p has a fold more similar to PRP18 than to an RRM and does not directly bind to the SRA1 RNA STR7 region.
24486609 2014 Structure and function of steroid receptor RNA activator protein, the proposed partner of SRA noncoding RNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23907597 2013 Steroid receptor RNA activator protein (SRAP) expression as a prognostic factor in ER+ human breast tumors.
23749764 2014 Influence of ovarian endometrioma on expression of steroid receptor RNA activator, estrogen receptors, vascular endothelial growth factor, and thrombospondin 1 in the surrounding ovarian tissues.
23579816 2013 Expression of both estrogen receptor-beta 1 (ER-?1) and its co-regulator steroid receptor RNA activator protein (SRAP) are predictive for benefit from tamoxifen therapy in patients with estrogen receptor-alpha (ER-?)-negative early breast cancer (EBC).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...