Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.43
PubTator Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.016 0.038
intraductal papillary-mucinous carcinoma... -1.100 0.009
lung cancer -1.600 0.001
group 4 medulloblastoma 1.400 0.000
lung carcinoma 1.600 0.000
Breast cancer -1.800 0.000
ovarian cancer -1.300 0.000

Gene RIF (1)

PMID Text
25738173 results obtained in vitro for helper lymphocytes of healthy individuals seem to mimic the regulatory effect of TNFalpha on the expression of ZNF334 in the cells of RA patients

AA Sequence

MKMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGYHVSKPDVIFKLEQGEEPWI      1 - 70
VEEFSNQNYPDIDDALEKNKEIQDKHLTQTVFFSNKTLITERENVFGKTLNLGMNSVPSRKMPYKCNPGG     71 - 140
NSLKTNSEVIVAKKSKENRKIPDGYSGFGKHEKSHLGMKKYRYNPMRKASNQNENLILHQNIQILKQPFD    141 - 210
YNKCGKTFFKRAILITQKGRQTERKPNECNECRKTFSKRSTLIVHQRIHTGEKPYVCSDCRKTFRVKTSL    211 - 280
TRHRRIHTGERPYECSECRKTFIDKSALIVHQKIHGGEKSYECNECGKTFFRKSALAEHFRSHTGEKPYE    281 - 350
CKECGNAFSKKSYLVVHQRTHRGEKPNECKECGKTFFCQSALTAHQRIHTGEKPYECSECEKTFFCQSAL    351 - 420
NVHRRSHTGEKPYECSQCGKFLCTKSALIAHQITHRGKKSYECNECGKFFCHKSTLTIHQRTHTGEKHGV    421 - 490
FNKCGRISIVKSNCSQCKRMNTKENLYECSEHGHAVSKNSHLIVHQRTIWERPYECNECGRTYCRKSALT    491 - 560
HHQRTHTGQRPYECNECGKTFCQKFSFVEHQRTHTGEKPYECNECGKSFCHKSAFRVHRRIHTGEKPYEC    561 - 630
NQCGKTYRRLWTLTEHQKIHTGEKPYECNKCEKTFRHKSNFLLHQKSHKE                        631 - 680
//

Text Mined References (8)

PMID Year Title
25738173 2015 The in vitro modulatory effect of TNF? on the mRNA expression and protein levels of zinc finger protein ZNF334 in CD4(+) lymphocytes of healthy people.
20738421 2011 Varying expression of four genes sharing a common regulatory sequence may differentiate rheumatoid arthritis from ageing effects on the CD4(+) lymphocytes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.