Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.43
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -1.500 1.3e-14
group 4 medulloblastoma 1.400 1.1e-06
intraductal papillary-mucinous carcinoma... -1.100 9.5e-03
lung cancer -1.600 1.2e-03
lung carcinoma 1.600 2.3e-16
osteosarcoma -1.016 3.8e-02
ovarian cancer -1.300 6.9e-05

Gene RIF (1)

AA Sequence

MKMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGYHVSKPDVIFKLEQGEEPWI      1 - 70
VEEFSNQNYPDIDDALEKNKEIQDKHLTQTVFFSNKTLITERENVFGKTLNLGMNSVPSRKMPYKCNPGG     71 - 140
NSLKTNSEVIVAKKSKENRKIPDGYSGFGKHEKSHLGMKKYRYNPMRKASNQNENLILHQNIQILKQPFD    141 - 210
YNKCGKTFFKRAILITQKGRQTERKPNECNECRKTFSKRSTLIVHQRIHTGEKPYVCSDCRKTFRVKTSL    211 - 280
TRHRRIHTGERPYECSECRKTFIDKSALIVHQKIHGGEKSYECNECGKTFFRKSALAEHFRSHTGEKPYE    281 - 350
CKECGNAFSKKSYLVVHQRTHRGEKPNECKECGKTFFCQSALTAHQRIHTGEKPYECSECEKTFFCQSAL    351 - 420
NVHRRSHTGEKPYECSQCGKFLCTKSALIAHQITHRGKKSYECNECGKFFCHKSTLTIHQRTHTGEKHGV    421 - 490
FNKCGRISIVKSNCSQCKRMNTKENLYECSEHGHAVSKNSHLIVHQRTIWERPYECNECGRTYCRKSALT    491 - 560
HHQRTHTGQRPYECNECGKTFCQKFSFVEHQRTHTGEKPYECNECGKSFCHKSAFRVHRRIHTGEKPYEC    561 - 630
NQCGKTYRRLWTLTEHQKIHTGEKPYECNKCEKTFRHKSNFLLHQKSHKE                        631 - 680
//

Text Mined References (8)

PMID Year Title