Property Summary

NCBI Gene PubMed Count 34
PubMed Score 22.80
PubTator Score 23.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession Q9HCY8 Q5RHT0
Symbols BCMP84
S100A15

Gene

PDB

2M0R  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (17)

AA Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN      1 - 70
LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH                                         71 - 104
//

Text Mined References (35)

PMID Year Title