Property Summary

NCBI Gene PubMed Count 33
Grant Count 1
Funding $132,297.67
PubMed Score 20.37
PubTator Score 23.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9HCY8 Q5RHT0
Symbols BCMP84
S100A15

Gene

 Grant Application (1)

PDB

2M0R  

Gene RIF (16)

PMID Text
25912829 S100A14 is expressed in epithelial-like, but not in mesenchymal-like, triple-negative breast cancer cells in vitro.
25884418 Co-expression of S100A14 and S100A16 correlates with a poor prognosis in human breast cancer and promotes cancer cell invasion
25502330 The antimicrobial peptides psoriasin (S100A7) and koebnerisin (S100A15) suppress extracellular matrix production and proliferation of human fibroblasts
25266115 Data show that the genetic variant 425G>A on the 5'-UTR of calcium-binding protein S100A14 was associated with reduced S100A14 expression in gastric cancer (GC) cells.
24939856 Data indicate that S100A14 has a crucial role in EOC progression, and its overexpression is associated with poor prognosis.
24285542 Data show that S100A14 and HER2 are colocalized in plasma membrane of breast cancer tissue cells and breast cancer cell lines.
24107296 Data demonstrate that S100A14 is transcriptionally regulated by JunB and involved in esophageal squamous cell carcinoma cell differentiation.
24086685 S100A14 interacts with S100A16 and regulates its expression in human cancer cells.
23886191 High S100A14 expression is associated with metastasis of hepatocellular carcinoma.
23197251 The solution structure of homodimeric S100A14 in the apo state solved by NMR
More...

AA Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN      1 - 70
LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH                                         71 - 104
//

Text Mined References (34)

PMID Year Title
25912829 2015 S100A14 is a novel independent prognostic biomarker in the triple-negative breast cancer subtype.
25884418 2015 Co-expression of S100A14 and S100A16 correlates with a poor prognosis in human breast cancer and promotes cancer cell invasion.
25502330 2015 The antimicrobial peptides psoriasin (S100A7) and koebnerisin (S100A15) suppress extracellular matrix production and proliferation of human fibroblasts.
25416956 2014 A proteome-scale map of the human interactome network.
25266115 2015 Downregulation of 425G>a variant of calcium-binding protein S100A14 associated with poor differentiation and prognosis in gastric cancer.
24939856 2014 The role of S100A14 in epithelial ovarian tumors.
24285542 2014 S100A14, a member of the EF-hand calcium-binding proteins, is overexpressed in breast cancer and acts as a modulator of HER2 signaling.
24107296 2013 S100A14: novel modulator of terminal differentiation in esophageal cancer.
24086685 2013 S100A14 interacts with S100A16 and regulates its expression in human cancer cells.
23886191 2013 S100A14 promotes the growth and metastasis of hepatocellular carcinoma.
More...