Property Summary

NCBI Gene PubMed Count 15
PubMed Score 199.76
PubTator Score 76.58

Knowledge Summary

Patent (4,184)

TINX Plot

  Disease (4)

Disease Target Count
Bipolar Disorder 666
Bipolar I disorder 23
Disease Target Count P-value
pituitary cancer 1972 4.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Autosomal recessive Robinow syndrome 27 3.2 1.6
lung cancer 4740 3.176 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 2.600 4.7e-05

Gene RIF (12)

AA Sequence

MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLN      1 - 70
FNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILNHPAFAQGQRLTLS     71 - 140
PLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKD    141 - 210
SFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDL    211 - 280
CRDTEEVEAILNGDVNFQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAV    281 - 350
KFLAVFGVSIGLPFLAIAYWIAPCSKLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNET    351 - 420
FTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARF    421 - 490
MAFLKATEAQLYVDQHVQDDTLHNVSLPPEVAYFTYARDKWWPSDPQIISEGLYAIAVVLSFSRIAYILP    491 - 560
ANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAKYNPAFTTVEESFKTLFWSIFGL    561 - 630
SEVISVVLKYDHKFIENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFD    631 - 700
EGRTLPAPFNLVPSPKSFYYLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTA    701 - 770
NNTLSKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQ    771 - 840
LSEKFGKNLNKDHLRVNKGKDI                                                    841 - 862
//

Text Mined References (18)

PMID Year Title