Property Summary

NCBI Gene PubMed Count 15
Grant Count 16
R01 Count 4
Funding $2,940,440.18
PubMed Score 198.91
PubTator Score 76.58

Knowledge Summary

Patent (4,184)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 2.600 0.000

Gene RIF (12)

PMID Text
24470487 A fundamental role for PI(4,5)P2 was identified in the regulation of TRPC7 and TRPC6.
21402151 Phosphorylation of transient receptor potential cation channel subfamily C member 7 significantly suppressed carbachol-induced calcium influx and CREB phosphorylation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19812035 heteromeric cation channels comprised of the TRPP2 mutant and the TRPC3 or TRPC7 protein induce enhanced receptor-activated Ca(2+) influx that may lead to dysregulated cell growth in ADPKD
19240791 Observational study of gene-disease association. (HuGE Navigator)
18021175 Expression and activity of TRPM7 is modulated by extracellular Mg2+ and Ca2+ availability, indicating that TRPM7 channels are involved in intracellular ion homeostasis and proliferation of osteoblasts.
17217055 the physiological importance of TRPC7 in the native environment remains elusive, TRPC7 would play important roles in Ca2+ signaling pathway--{REVIEW}
16741513 activation of both muscarinic and purinergic receptors via a common DAG-dependent link opens Ca(2+)-permeable TRPC7 channels
16123040 in B-lymphocytes, TRPC7 appears to participate in the formation of ion channels that could be activated by phospholipase C-linked receptors
15972814 endogenous TRPC1, TRPC3, and TRPC7 participate in forming heteromeric store-operated channels, whereas TRPC3 and TRPC7 can also participate in forming heteromeric receptor-operated channels.
More...

AA Sequence

MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLN      1 - 70
FNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILNHPAFAQGQRLTLS     71 - 140
PLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKD    141 - 210
SFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDL    211 - 280
CRDTEEVEAILNGDVNFQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAV    281 - 350
KFLAVFGVSIGLPFLAIAYWIAPCSKLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNET    351 - 420
FTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARF    421 - 490
MAFLKATEAQLYVDQHVQDDTLHNVSLPPEVAYFTYARDKWWPSDPQIISEGLYAIAVVLSFSRIAYILP    491 - 560
ANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAKYNPAFTTVEESFKTLFWSIFGL    561 - 630
SEVISVVLKYDHKFIENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFD    631 - 700
EGRTLPAPFNLVPSPKSFYYLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTA    701 - 770
NNTLSKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQ    771 - 840
LSEKFGKNLNKDHLRVNKGKDI                                                    841 - 862
//

Text Mined References (18)

PMID Year Title
24470487 2014 PLC-mediated PI(4,5)P2 hydrolysis regulates activation and inactivation of TRPC6/7 channels.
21402151 2011 Functional regulation of transient receptor potential canonical 7 by cGMP-dependent protein kinase I?.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19812035 2009 A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7.
19240791 2009 Integrated genomic analysis implicates haploinsufficiency of multiple chromosome 5q31.2 genes in de novo myelodysplastic syndromes pathogenesis.
18021175 2007 Importance of melastatin-like transient receptor potential 7 and cations (magnesium, calcium) in human osteoblast-like cell proliferation.
17850865 2008 RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC.
17217055 2007 TRPC7.
16741513 2006 TRPC7 is a receptor-operated DAG-activated channel in human keratinocytes.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
More...