Property Summary

NCBI Gene PubMed Count 81
PubMed Score 54.94
PubTator Score 107.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Disease Target Count Z-score Confidence
Cancer 2499 3.973 2.0

Expression

Gene RIF (66)

AA Sequence

MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ      1 - 70
FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQG     71 - 140
AKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG    141 - 210
PYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDGP                                      211 - 246
//

Text Mined References (84)

PMID Year Title