Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.32
PubTator Score 12.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

AA Sequence

MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRW      1 - 70
CRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL                                      71 - 107
//

Text Mined References (29)

PMID Year Title