Property Summary

NCBI Gene PubMed Count 22
Grant Count 134
R01 Count 67
Funding $13,843,093.64
PubMed Score 7.32
PubTator Score 12.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9HCU8 F5H506
Symbols p12
POLDS

Gene

Gene RIF (10)

PMID Text
24691096 the p12/Pol delta is a target as a nuclear substrate of mu-calpain in a calcium-triggered apoptosis and appears to be a potential marker in the study of the chemotherapy of cancer therapies.
24300032 A parallel study of Pol delta4 and Pol delta3 in Okazaki fragment processing provides evidence for a role of Pol delta3 in DNA replication
24035200 Findings provide evidence for the novel concept that Pol delta3 has a role in lagging strand synthesis, and that both forms of Pol delta3 and 4 may participate in DNA replication in higher eukaryotic cells.
24022480 ubiquitination of p12 through CRL4(Cdt2) and subsequent degradation form one mechanism by which a cell responds to DNA damage to inhibit fork progression.
23913683 Data indicate that CRL4(Cdt2) regulates the degradation of the p12 subunit of Pol delta4.
23233665 The identification of RNF8 allows new insights into the integration of the control of p12 degradation by different DNA damage signaling pathways.
20861182 Low POLD4 is associated with lung cancer.
19931513 these results indicate that POLD4 is required for the in vitro pol delta activity, and that it functions in cell proliferation and maintenance of genomic stability of human cells.
18682526 The DNA polymerase delta enzyme, as well as the isolated p12 subunit, stimulates the DNA helicase activity of Bloom's syndrome helicase.
16510448 pol delta interacts with PCNA via at least two of its subunits, and p12 could play a role in stabilizing the overall pol delta-PCNA complex as well as pol delta itself

AA Sequence

MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRW      1 - 70
CRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL                                      71 - 107
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24691096 2014 Proteolysis of the human DNA polymerase delta smallest subunit p12 by ?-calpain in calcium-triggered apoptotic HeLa cells.
24300032 2014 The tail that wags the dog: p12, the smallest subunit of DNA polymerase ?, is degraded by ubiquitin ligases in response to DNA damage and during cell cycle progression.
24035200 2013 Dynamics of enzymatic interactions during short flap human Okazaki fragment processing by two forms of human DNA polymerase ?.
24022480 2013 Degradation of p12 subunit by CRL4Cdt2 E3 ligase inhibits fork progression after DNA damage.
23913683 2013 A novel function of CRL4(Cdt2): regulation of the subunit structure of DNA polymerase ? in response to DNA damage and during the S phase.
23233665 2013 Identification of RNF8 as a ubiquitin ligase involved in targeting the p12 subunit of DNA polymerase ? for degradation in response to DNA damage.
20861182 2010 Regulation of DNA polymerase POLD4 influences genomic instability in lung cancer.
19931513 2010 Roles of POLD4, smallest subunit of DNA polymerase delta, in nuclear structures and genomic stability of human cells.
18682526 2008 The Bloom's syndrome helicase (BLM) interacts physically and functionally with p12, the smallest subunit of human DNA polymerase delta.
More...