Property Summary

NCBI Gene PubMed Count 17
PubMed Score 221.68
PubTator Score 158.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 6.2e-06
ovarian cancer 8519 1.1e-05
tuberculosis and treatment for 6 months 409 1.7e-04
colon cancer 1478 6.7e-04
osteosarcoma 7950 2.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Leukemia 104 4.881 2.4
Testicular leukemia 1 3.578 1.8
Lymphoma 81 3.067 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.100 6.7e-04
lung cancer 2.600 6.2e-06
osteosarcoma -1.109 2.1e-03
ovarian cancer 1.900 1.1e-05
tuberculosis and treatment for 6 months -1.300 1.7e-04

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MGRRRAPELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETR      1 - 70
ATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELR     71 - 140
VENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDLALGPDGKL    141 - 210
VTVGRDLKASVWQKDQLVTQLHWQENGPTFSSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPC    211 - 280
YLTAWDGSNFLPLRTKSCGHEVVSCLDVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVA    281 - 350
FLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCVGLIIVTILLLQSAFPGFL       351 - 417
//

Text Mined References (20)

PMID Year Title