Property Summary

NCBI Gene PubMed Count 17
Grant Count 197
R01 Count 151
Funding $18,883,405.8
PubMed Score 214.30
PubTator Score 158.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.109 0.002
tuberculosis and treatment for 6 months -1.300 0.000
lung cancer 2.600 0.000
colon cancer 1.100 0.001
ovarian cancer 1.900 0.000

Synonym

Accession Q9HCU5 Q53SZ8 Q9UH94
Symbols SEC12

Gene

Gene RIF (6)

PMID Text
26739056 These results indicate that PREB locates at the hepatitis C virus replication complex by interacting with NS4B.
25202031 Sec12, a guanine-nucleotide exchange factor for Sar1 guanosine triphosphatase, is concentrated at endoplasmic reticulum exit sites and that this concentration of Sec12 is specifically required for the secretion of collagen VII but not other proteins.
22190034 HIV-1 Vpu is identified to have a physical interaction with prolactin regulatory element binding (PREB) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20643408 PREB regulates the cAMP-mediated transcription of the ABCA1 gene in vascular smooth muscle cells
19426980 The transcriptional factor PREB mediates MCP-1 transcription induced by cytokines in human vascular endothelial cells.
19086053 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRRRAPELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETR      1 - 70
ATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELR     71 - 140
VENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDLALGPDGKL    141 - 210
VTVGRDLKASVWQKDQLVTQLHWQENGPTFSSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPC    211 - 280
YLTAWDGSNFLPLRTKSCGHEVVSCLDVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVA    281 - 350
FLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCVGLIIVTILLLQSAFPGFL       351 - 417
//

Text Mined References (20)

PMID Year Title
27170179 2016 Dual function of cTAGE5 in collagen export from the endoplasmic reticulum.
26739056 2016 Prolactin Regulatory Element Binding Protein Is Involved in Hepatitis C Virus Replication by Interaction with NS4B.
25202031 2014 Concentration of Sec12 at ER exit sites via interaction with cTAGE5 is required for collagen export.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20643408 2010 Transcriptional factor prolactin regulatory element-binding protein-mediated gene transcription of ABCA1 via 3',5'-cyclic adenosine-5'-monophosphate.
19946888 2010 Defining the membrane proteome of NK cells.
19426980 2009 The transcriptional factor PREB mediates MCP-1 transcription induced by cytokines in human vascular endothelial cells.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...