Property Summary

NCBI Gene PubMed Count 32
Grant Count 45
R01 Count 25
Funding $6,595,332.72
PubMed Score 1142.73
PubTator Score 309.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26336878 TEM1 expression in cancer-associated fibroblasts is correlated with a poor prognosis in patients with gastric cancer
26327620 MORAb-004 reduced CD248 on pericytes, impaired tumor microvasculature maturation and ultimately suppressed tumor development.
25680861 The authors show that endosialin, a C-type lectin, expressed in the liver exclusively by HSC and portal fibroblasts, is upregulated in liver fibrosis in mouse and man.
24716914 The genes CD248, Ephb1 and P2RY2 were detected as the top overexpressed in GC biopsies.
22824847 new monoclonal antibodies described in this paper are domain-specific and represent important reagents for the study of functional contributions of extracellular endosialin domains
22206249 [review] CD248 is a C-type lectin-like domain-containing cell surface glycoprotein that is expressed by stromal cells of proliferating tissues during embryogenesis and postnatally in tumors and inflammatory lesions.
21537839 endosialin can be detected in advanced sarcoma
21490589 CD248 defines a subset of stromal cells, including but not limited to some myofibroblasts, linked to albuminuria and tubulointerstitial damage during tissue remodeling in CKD.
21362178 Endosialin expression may be involved in the progression of rectal cancers.
20484976 Results provide evidence for a TEM-1-dependent signal pathway that controls proliferation of pericytes.
More...

AA Sequence

MLLRLLLAWAAAGPTLGQDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRV      1 - 70
DSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEH     71 - 140
RWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGAS    141 - 210
LLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPC    211 - 280
EQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISC    281 - 350
SPAGAMGAQASQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREP    351 - 420
QIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATHPTLPSAHQPPVIPATHPALSRDHQIPVIAANYP    421 - 490
DLPSAYQPGILSVSHSAQPPAHQPPMISTKYPELFPAHQSPMFPDTRVAGTQTTTHLPGIPPNHAPLVTT    491 - 560
LGAQLPPQAPDALVLRTQATQLPIIPTAQPSLTTTSRSPVSPAHQISVPAATQPAALPTLLPSQSPTNQT    561 - 630
SPISPTHPHSKAPQIPREDGPSPKLALWLPSPAPTAAPTALGEAGLAEHSQRDDRWLLVALLVPTCVFLV    631 - 700
VLLALGIVYCTRCGPHAPNKRITDCYRWVIHAGSKSPTEPMPPRGSLTGVQTCRTSV                 701 - 757
//

Text Mined References (34)

PMID Year Title
26782745 2016 Efficient construct of a large and functional scFv yeast display library derived from the ascites B cells of ovarian cancer patients by three-fragment transformation-associated recombination.
26336878 2015 TEM1 expression in cancer-associated fibroblasts is correlated with a poor prognosis in patients with gastric cancer.
26327620 2015 Targeting endosialin/CD248 through antibody-mediated internalization results in impaired pericyte maturation and dysfunctional tumor microvasculature.
25680861 2015 Hepatic stellate cell-expressed endosialin balances fibrogenesis and hepatocyte proliferation during liver damage.
24716914 2014 Increased expression of P2RY2, CD248 and EphB1 in gastric cancers from Chilean patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22824847 2012 Novel monoclonal antibodies specific for CTLD-SSC and sialomucin domains of endosialin, a mural cell marker of tumor vasculature.
22206249 2012 CD248: reviewing its role in health and disease.
More...