Property Summary

NCBI Gene PubMed Count 12
PubMed Score 16.53
PubTator Score 4.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.9e-18
osteosarcoma 7950 2.3e-07

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.553 2.3e-07
psoriasis -1.300 2.9e-18

Protein-protein Interaction (1)

AA Sequence

MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQ      1 - 70
DSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMF     71 - 140
LALDRRGGPRPGGRTRRYHLSAHFLPVLVS                                            141 - 170
//

Text Mined References (14)

PMID Year Title