Property Summary

NCBI Gene PubMed Count 12
Grant Count 29
R01 Count 10
Funding $2,907,430.85
PubMed Score 15.21
PubTator Score 4.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.553 0.000
psoriasis -1.300 0.000

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
651658 screening 5128 / 6 / 337955 Small Molecule Inhibitors of FGF22-Mediated Excitatory Synaptogenesis & Epilepsy Measured in Biochemical System Using RT-PCR - 7012-01_Inhibitor_SinglePoint_HTS_Activity
651666 summary 0 / 0 / 0 Broad Institute Small Molecule Inhibitors of FGF22-Mediated Excitatory Synaptogenesis & Epilepsy Inhibitor Probe Project
687022 confirmatory 364 / 4 / 657 Small Molecule Inhibitors of FGF22-Mediated Excitatory Synaptogenesis & Epilepsy Measured in Biochemical System Using RT-PCR - 7012-01_Inhibitor_Dose_CherryPick_Activity
720646 confirmatory 24 / 0 / 1002 Small Molecule Inhibitors of FGF22-Mediated Excitatory Synaptogenesis & Epilepsy Measured in Biochemical System Using RT-PCR - 7012-04_Inhibitor_Dose_CherryPick_Activity
743017 confirmatory 0 / 0 / 50 Small Molecule Inhibitors of FGF22-Mediated Excitatory Synaptogenesis & Epilepsy Measured in Biochemical System Using RT-PCR - 7012-04_Inhibitor_Dose_DryPowder_Activity
743019 confirmatory 23 / 0 / 1003 Small Molecule Inhibitors of FGF22-Mediated Excitatory Synaptogenesis & Epilepsy Measured in Biochemical System Using RT-PCR - 7012-03_Inhibitor_Dose_CherryPick_Activity
743116 confirmatory 10 / 0 / 40 Small Molecule Inhibitors of FGF22-Mediated Excitatory Synaptogenesis & Epilepsy Measured in Biochemical System Using RT-PCR - 7012-01_Inhibitor_Dose_DryPowder_Activity

AA Sequence

MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQ      1 - 70
DSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMF     71 - 140
LALDRRGGPRPGGRTRRYHLSAHFLPVLVS                                            141 - 170
//

Text Mined References (14)

PMID Year Title
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
17133345 2007 Differential signal transduction of alternatively spliced FGFR2 variants expressed in human mammary epithelial cells.
16597617 2006 Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.
15806171 2005 The fibroblast growth factor binding protein is a novel interaction partner of FGF-7, FGF-10 and FGF-22 and regulates FGF activity: implications for epithelial repair.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15260994 2004 FGF22 and its close relatives are presynaptic organizing molecules in the mammalian brain.
15199049 2004 Functional phylogeny relates LET-756 to fibroblast growth factor 9.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12660731 2003 The role of PI3K in immune cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...