Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.08
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.450 2.4e-03
active ulcerative colitis 1.429 6.4e-03
adult high grade glioma 1.100 3.3e-03
Astrocytoma, Pilocytic 1.200 2.5e-04
atypical teratoid / rhabdoid tumor 1.500 3.1e-04
cutaneous lupus erythematosus -1.600 7.7e-03
ependymoma 1.300 1.0e-06
glioblastoma 1.100 2.0e-03
group 3 medulloblastoma 1.500 3.8e-03
lung adenocarcinoma -1.100 7.8e-11
lung cancer -3.400 7.5e-05
lung carcinoma -1.500 2.6e-07
malignant mesothelioma 1.100 7.6e-05
medulloblastoma, large-cell 1.100 4.9e-04
mucosa-associated lymphoid tissue lympho... 1.332 1.5e-02
non-small cell lung cancer -1.322 1.1e-13
osteosarcoma -3.460 7.8e-10
ovarian cancer -1.400 2.3e-05
primitive neuroectodermal tumor 1.800 9.0e-05
psoriasis -1.200 9.1e-04
subependymal giant cell astrocytoma 1.506 1.0e-02

Synonym

Accession Q9HCS5 A4FUI6
Symbols NBL4
EPB41L4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (10)

Gene RIF (1)

AA Sequence

MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYW      1 - 70
LDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGA     71 - 140
YAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQIPSEAELNYLRTAKSLEMYGVDL    141 - 210
HPVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTA    211 - 280
CKHLWKCSVEHHTFFRMPENESNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSK    281 - 350
TYPKRIAQTQPAESNSISRITANMENGENEGTIKIIAPSPVKSFKKAKNENSPDTQRSKSHAPWEENGPQ    351 - 420
SGLYNSPSDRTKSPKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESEN    421 - 490
SNREYRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKEL    491 - 560
VDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPLPVTR    561 - 630
SSDAQGSGDATVHQRRNGSKDSLMEEKPQTSTNNLAGKHTAKTIKTIQASRLKTET                  631 - 686
//

Text Mined References (12)

PMID Year Title