Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.07
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Failure to gain weight 4
Disease Target Count P-value
non-small cell lung cancer 2798 1.05574765337766E-13
lung adenocarcinoma 2714 7.8425435841546E-11
osteosarcoma 7933 7.83877041145626E-10
posterior fossa group B ependymoma 1530 9.10417680631312E-9
malignant mesothelioma 3163 2.06992240105801E-8
lung carcinoma 2844 2.603304258876E-7
lung cancer 4473 6.53198758573546E-6
psoriasis 6685 1.71187084735773E-5
sonic hedgehog group medulloblastoma 1482 1.91365545041451E-5
ovarian cancer 8492 2.29676781514008E-5
primitive neuroectodermal tumor 3031 8.99037567390415E-5
pilocytic astrocytoma 3086 1.94161219049081E-4
medulloblastoma, large-cell 6234 4.89248341326191E-4
glioblastoma 5572 0.00198029794776147
active Crohn's disease 918 0.00238827347440619
adult high grade glioma 2148 0.00327523505753058
atypical teratoid / rhabdoid tumor 4369 0.00386633549627429
active ulcerative colitis 477 0.00643417523300939
cutaneous lupus erythematosus 1056 0.00765572377902071
subependymal giant cell astrocytoma 2287 0.0103660665821475
mucosa-associated lymphoid tissue lymphoma 480 0.0147914333058208
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 1.0
Disease Target Count Z-score Confidence
Teratocarcinoma 8 3.214 1.6

Expression

Synonym

Accession Q9HCS5 A4FUI6
Symbols NBL4
EPB41L4

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYW      1 - 70
LDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGA     71 - 140
YAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQIPSEAELNYLRTAKSLEMYGVDL    141 - 210
HPVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTA    211 - 280
CKHLWKCSVEHHTFFRMPENESNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSK    281 - 350
TYPKRIAQTQPAESNSISRITANMENGENEGTIKIIAPSPVKSFKKAKNENSPDTQRSKSHAPWEENGPQ    351 - 420
SGLYNSPSDRTKSPKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESEN    421 - 490
SNREYRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKEL    491 - 560
VDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPLPVTR    561 - 630
SSDAQGSGDATVHQRRNGSKDSLMEEKPQTSTNNLAGKHTAKTIKTIQASRLKTET                  631 - 686
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10874211 2000 Isolation and characterization of human NBL4, a gene involved in the beta-catenin/tcf signaling pathway.
10783258 2000 Molecular cloning of a novel NF2/ERM/4.1 superfamily gene, ehm2, that is expressed in high-metastatic K1735 murine melanoma cells.
More...