Property Summary

NCBI Gene PubMed Count 19
PubMed Score 17.12
PubTator Score 15.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.200 5.4e-03
atypical teratoid / rhabdoid tumor 1.900 2.9e-06
Breast cancer -1.800 1.2e-05
breast carcinoma -1.100 9.0e-06
cystic fibrosis -1.426 9.6e-05
ductal carcinoma in situ -1.700 4.2e-03
ependymoma 1.700 1.3e-11
glioblastoma 1.100 8.9e-04
invasive ductal carcinoma -1.419 8.2e-05
lung carcinoma -1.100 3.5e-20
malignant mesothelioma 5.100 5.7e-10
oligodendroglioma 1.200 5.2e-13
pediatric high grade glioma 1.300 1.6e-03
primitive neuroectodermal tumor 1.600 6.4e-03
psoriasis -1.400 6.8e-11

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLV      1 - 70
NESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPGYPFLMIPDLSSPYLSNGPL     71 - 140
SPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPGSPPTH    141 - 210
LSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASM    211 - 280
SSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPL    281 - 350
NAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG    351 - 420
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPA    421 - 490
APAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPPLLSRPLPLGSMPTALLASPP    491 - 560
SFPATLHAHQALPVLQAQPLSLVTKSAH                                              561 - 588
//

Text Mined References (20)

PMID Year Title