Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
R01 Count 2
Funding $210,887.33
PubMed Score 14.37
PubTator Score 15.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 5.100 0.000
astrocytoma 1.400 0.000
psoriasis -1.400 0.000
oligodendroglioma 1.200 0.000
posterior fossa group A ependymoma 2.000 0.000
glioblastoma 1.500 0.003
cystic fibrosis -1.426 0.000
atypical teratoid / rhabdoid tumor 1.900 0.000
primitive neuroectodermal tumor 1.600 0.006
breast carcinoma -1.100 0.000
pediatric high grade glioma 1.300 0.002
invasive ductal carcinoma -2.000 0.017
Breast cancer -1.800 0.000
lung carcinoma -1.100 0.000
ductal carcinoma in situ -1.700 0.004

Synonym

Accession Q9HCS4 Q53R97 Q6PD70 Q9NP00
Symbols TCF3
TCF-3

Gene

PANTHER Protein Class (1)

 Grant Application (2)

 IMPC Term (1)

Gene RIF (5)

PMID Text
26764381 report the identification of two independent missense variants in human TCF7L1, p.R92P and p.R400Q, in a cohort of patients with forebrain and/or pituitary defects
22930747 Data indicate that median methylation levels of BCAN, HOXD1, KCTD8, KLF11, NXPH1, POU4F1, SIM1, and TCF7L1 were >/=30% higher than in normal samples, representing potential biomarkers for tumor diagnosis.
20532534 No difference in nuclear beta-catenin signal intensity was found, which may be caused by an alteration in Wnt pathway in microsatellite stable sporadic tumors by unknown mechanisms leading to lower TCF-3, 4 protein expression.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19308021 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLV      1 - 70
NESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPGYPFLMIPDLSSPYLSNGPL     71 - 140
SPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPGSPPTH    141 - 210
LSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASM    211 - 280
SSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPL    281 - 350
NAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG    351 - 420
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPA    421 - 490
APAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPPLLSRPLPLGSMPTALLASPP    491 - 560
SFPATLHAHQALPVLQAQPLSLVTKSAH                                              561 - 588
//

Text Mined References (20)

PMID Year Title
26764381 2016 Transcription factor 7-like 1 is involved in hypothalamo-pituitary axis development in mice and humans.
22930747 2012 Genome-wide methylation screen in low-grade breast cancer identifies novel epigenetically altered genes as potential biomarkers for tumor diagnosis.
20532534 2010 TCF-3, 4 protein expression correlates with beta-catenin expression in MSS and MSI-H colorectal cancer from HNPCC patients but not in sporadic colorectal cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19906297 2009 INTS6/DICE1 inhibits growth of human androgen-independent prostate cancer cells by altering the cell cycle profile and Wnt signaling.
19373426 2010 Wnt pathway genes in osteoporosis and osteoarthritis: differential expression and genetic association study.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
19301967 2009 Candidate genes for sensitivity and resistance of human glioblastoma multiforme cell lines to erlotinib. Laboratory investigation.
18258400 2008 Identification of replicative senescence-associated genes in human umbilical vein endothelial cells by an annealing control primer system.
17873379 2007 Networking of WNT, FGF, Notch, BMP, and Hedgehog signaling pathways during carcinogenesis.
More...