Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.48
PubTator Score 16.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -1.142 1.5e-02
astrocytic glioma 1.400 2.5e-02
atypical teratoid / rhabdoid tumor 1.100 4.2e-03
cutaneous lupus erythematosus -2.000 2.4e-02
ependymoma 1.600 4.1e-06
interstitial cystitis -1.500 2.6e-04
ovarian cancer -1.400 3.4e-05
ulcerative colitis -1.500 5.9e-07

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGLITPT      1 - 70
EEGLKNSTQMSATYSQGFTIWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSG     71 - 140
GDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSCLDMFEHISLMTLDSLQKCIFSF    141 - 210
DSHCQERPSEYIATILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPT    211 - 280
QGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEY    281 - 350
QERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITC    351 - 420
LIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFR    421 - 490
FLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ                                        491 - 524
//

Text Mined References (25)

PMID Year Title