Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.32
PubTator Score 16.67

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
posterior fossa group A ependymoma 1511 5.18104581090668E-12
ulcerative colitis 2087 5.91568026521607E-7
ovarian cancer 8492 3.3762977197647E-5
interstitial cystitis 2299 2.64308184160001E-4
atypical teratoid / rhabdoid tumor 4369 0.00423764728995129
active Crohn's disease 918 0.0153345788636328
cutaneous lupus erythematosus 1056 0.0239241081389166
astrocytic glioma 2241 0.0250960609807167


  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.400 0.025
cutaneous lupus erythematosus -2.000 0.024
posterior fossa group A ependymoma 2.200 0.000
atypical teratoid / rhabdoid tumor 1.100 0.004
active Crohn's disease -1.142 0.015
interstitial cystitis -1.500 0.000
ulcerative colitis -1.500 0.000
ovarian cancer -1.400 0.000


Accession Q9HCS2 E7ET51 O60389 Q5JPJ7 Q9HCS1
Symbols CYPIVF12


PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (3)

26845356 Our results showed that HCV infection induced expression of CYP4F12 protein, which bound to the HCV replication complex to facilitate viral replication.
18065749 3-hydroxystearate and 3-hydroxypalmitate are converted to omega-hydroxylated 3-OHDCA precursors in liver; CYP4F11 and, to a lesser extent, CYP4F2 catalyzed omega-hydroxylation of 3-hydroxystearate; CYP4F3b, CYP4F12, and CYP4A11 had negligible activity.
16112640 We conclude that CYP4F8 and CYP4F12 catalyze epoxidation of 22:6n-3 and 22:5n-3, and CYP4F8 omega3-hydroxylation of 22:5n-6.

AA Sequence

FLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ                                        491 - 524

Text Mined References (25)

PMID Year Title
26845356 2016 Inducible CYP4F12 enhances Hepatitis C virus infection via association with viral nonstructural protein 5B.
19129222 2009 Identification of pregnane-X receptor target genes and coactivator and corepressor binding to promoter elements in human hepatocytes.
18828626 2008 Distinction between human cytochrome P450 (CYP) isoforms and identification of new phosphorylation sites by mass spectrometry.
18662666 2008 Expression of CYP4F2 in human liver and kidney: assessment using targeted peptide antibodies.
18065749 2008 Omega oxidation of 3-hydroxy fatty acids by the human CYP4F gene subfamily enzyme CYP4F11.
17980168 2007 Expression and physiological function of CYP4F subfamily in human eosinophils.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16112640 2005 Oxygenation of polyunsaturated long chain fatty acids by recombinant CYP4F8 and CYP4F12 and catalytic importance of Tyr-125 and Gly-328 of CYP4F8.