Property Summary

Ligand Count 52
NCBI Gene PubMed Count 45
PubMed Score 38.83
PubTator Score 49.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Pigmented Nodular Adrenocortical Disease, Primary, 2 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cushing's syndrome 48 4.934 2.5

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -1.100 4.7e-06
breast carcinoma -1.200 1.9e-03
ductal carcinoma in situ -1.600 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.2e-03
invasive ductal carcinoma -1.900 1.8e-03
pituitary cancer -1.700 4.5e-06
psoriasis -1.100 2.3e-11

Gene RIF (34)

AA Sequence

MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSSLAHSTCRGGS      1 - 70
SVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKELRKSFARSKAIHVNRTYDEQ     71 - 140
VTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRVNLPRYPPTAIDYKCHLKKHNERQFFLELVK    141 - 210
DISNDLDLTSLSYKILIFVCLMVDADRCSLFLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQV    211 - 280
PWGKGIIGYVGEHGETVNIPDAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAP    281 - 350
FTEDDEKVMQMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC    351 - 420
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVASTGLPVNISD    421 - 490
AYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINN    491 - 560
TIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIPLVSELAIDDIHFDDFSLDVDAMITAALRM    561 - 630
FMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVG    631 - 700
CLCHDLDHRGTNNAFQAKSGSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQ    701 - 770
SILATDLTLYFERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE    771 - 840
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVATNRSKWEELHQ    841 - 910
KRLLASTASSSPASVMVAKEDRN                                                   911 - 933
//

Text Mined References (46)

PMID Year Title